(data stored in ACNUC30630 zone)

EMBL: CP002344.PE73

CP002344.PE73        Location/Qualifiers
FT   CDS             69294..69626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0073"
FT                   /product="Uncharacterized protein family UPF0133"
FT                   /note="COGs: COG0718 conserved hypothetical protein;
FT                   InterPro IPR004401; KEGG: adg:Adeg_2129 hypothetical
FT                   protein; PFAM: Uncharacterised protein family UPF0133;
FT                   SPTR: UPF0133 protein Adeg_2129; PFAM: Uncharacterised BCR,
FT                   YbaB family COG0718; TIGRFAM: DNA-binding protein,
FT                   YbaB/EbfC family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50198"
FT                   /db_xref="GOA:E6SKZ6"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKZ6"
FT                   /protein_id="ADU50198.1"
FT                   /translation="MSFGPMGKMLKQLEKVQQEMARLQEELAQREVEATAGGGMVKAVV
FT                   NGRQELLRLEIAREAVDPDDVELLQDMIVAAVNEANRKAQELLQAEMARVTGGLKLPKL
FT                   PGFPGF"
     MSFGPMGKML KQLEKVQQEM ARLQEELAQR EVEATAGGGM VKAVVNGRQE LLRLEIAREA        60
     VDPDDVELLQ DMIVAAVNEA NRKAQELLQA EMARVTGGLK LPKLPGFPGF                  110
//

If you have problems or comments...

PBIL Back to PBIL home page