(data stored in ACNUC30630 zone)

EMBL: CP002344.PE80

CP002344.PE80        Location/Qualifiers
FT   CDS             80769..81767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0080"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG2812 DNA polymerase III gamma/tau subunits;
FT                   KEGG: saq:Sare_4403 DNA polymerase III, delta prime
FT                   subunit; SPTR: DNA polymerase III, delta prime subunit;
FT                   TIGRFAM: DNA polymerase III, delta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50205"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL03"
FT                   /protein_id="ADU50205.1"
FT                   /translation="MSEPMARLWSRRVSHAYLLAGPPGAGQREAADQVAAALLCPQARD
FT                   GIACGTCPACRQVAAGVHPDLIVPDGHGIDAVRRTLALLPLRPQAGPRKVVVWRDADRL
FT                   TPQAANALLKSVEEPPPFVVFLFTTDHLTAVLPTLRSRCRVVPFRPRPREERARDLAEA
FT                   TGVRLLAAYWALRVCGDVAAEARRYLDEPGCAAEVEGLEAAAAALEHGPLTAALDAARR
FT                   LAEWGDKAEAAADVLIWRLRQGDAGDDPGRRLGWTRALAAFRRAWQANANRQLALEVFA
FT                   WRCWAVTRGGGPAPAATATGHATGHLPGMGTGRVPGSGSPGRPGIVTRPGP"
     MSEPMARLWS RRVSHAYLLA GPPGAGQREA ADQVAAALLC PQARDGIACG TCPACRQVAA        60
     GVHPDLIVPD GHGIDAVRRT LALLPLRPQA GPRKVVVWRD ADRLTPQAAN ALLKSVEEPP       120
     PFVVFLFTTD HLTAVLPTLR SRCRVVPFRP RPREERARDL AEATGVRLLA AYWALRVCGD       180
     VAAEARRYLD EPGCAAEVEG LEAAAAALEH GPLTAALDAA RRLAEWGDKA EAAADVLIWR       240
     LRQGDAGDDP GRRLGWTRAL AAFRRAWQAN ANRQLALEVF AWRCWAVTRG GGPAPAATAT       300
     GHATGHLPGM GTGRVPGSGS PGRPGIVTRP GP                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page