(data stored in ACNUC30630 zone)

EMBL: CP002344.PE85

CP002344.PE85        Location/Qualifiers
FT   CDS             87870..88802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0085"
FT                   /product="dimethyladenosine transferase"
FT                   /note="COGs: COG0030 Dimethyladenosine transferase (rRNA
FT                   methylation); InterPro IPR020598: IPR001737: IPR011530:
FT                   IPR020596; KEGG: dau:Daud_0045 dimethyladenosine
FT                   transferase; PFAM: ribosomal RNA adenine methylase
FT                   transferase; PRIAM: rRNA (adenine-N(6)-)-methyltransferase;
FT                   SMART: Ribosomal RNA adenine methylase transferase-like;
FT                   SPTR: Ribosomal RNA small subunit methyltransferase A;
FT                   TIGRFAM: dimethyladenosine transferase; PFAM: Ribosomal RNA
FT                   adenine dimethylase; TIGRFAM: dimethyladenosine
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50210"
FT                   /db_xref="GOA:E6SL08"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL08"
FT                   /protein_id="ADU50210.1"
FT                   /translation="MEAGSSRDAEPITRRAELRRWLEQYGVRPSRRLGQNFLVDDHWAE
FT                   RIVGAVEPGPDDVVLEVGPGLGALTERLVRRAGRVVAVEVDRRLAEALRQRLACVDNFQ
FT                   LVVADVLQVDLADLVARHLAPVGGDDMPAVKLASNLPYAITSPFLVRWLGSSVRWERAV
FT                   LTLQAEVVDRLVAAPGTAAYGALTVFVAYHARVERLGIVPAGAFWPRPEVDSAVVRLWP
FT                   HPQPPVAVADPDALFALVRAAFSQRRKRLANALAAHPAVDRRQAEAACRAAGLDPGARP
FT                   EEVDLEGFARLANQLFSSAAGRGPGPSAS"
     MEAGSSRDAE PITRRAELRR WLEQYGVRPS RRLGQNFLVD DHWAERIVGA VEPGPDDVVL        60
     EVGPGLGALT ERLVRRAGRV VAVEVDRRLA EALRQRLACV DNFQLVVADV LQVDLADLVA       120
     RHLAPVGGDD MPAVKLASNL PYAITSPFLV RWLGSSVRWE RAVLTLQAEV VDRLVAAPGT       180
     AAYGALTVFV AYHARVERLG IVPAGAFWPR PEVDSAVVRL WPHPQPPVAV ADPDALFALV       240
     RAAFSQRRKR LANALAAHPA VDRRQAEAAC RAAGLDPGAR PEEVDLEGFA RLANQLFSSA       300
     AGRGPGPSAS                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page