(data stored in ACNUC30630 zone)

EMBL: CP002344.PE92

CP002344.PE92        Location/Qualifiers
FT   CDS             92907..94355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0092"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /note="COGs: COG1171 Threonine dehydratase; InterPro
FT                   IPR001926: IPR002912: IPR005789: IPR017975; KEGG:
FT                   drm:Dred_0097 threonine dehydratase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   amino acid-binding ACT domain protein; SPTR: L-threonine
FT                   ammonia-lyase; TIGRFAM: threonine dehydratase; PFAM: ACT
FT                   domain; Pyridoxal-phosphate dependent enzyme; TIGRFAM:
FT                   threonine ammonia-lyase, biosynthetic, long form; threonine
FT                   dehydratase, medium form"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50217"
FT                   /db_xref="GOA:E6SL15"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL15"
FT                   /protein_id="ADU50217.1"
FT                   /translation="MADGNASETVGHGPAAGGTGSGGAVIGGVEGGPGTGGARVDGAGG
FT                   AVSGTGERPEAVVPARAGGGQVPGGAGDPVDLEAIRRAAAAIAGFVHRTPLLGSAAFSE
FT                   LAGADVFLKLENLQKTGSFKVRGAFNRLSRLDAAARARGVICASAGNHAQGVALAGARL
FT                   GVPVTVVMPETAPTTKVVATRGYGAEVVLHGEGYDGAYDRACQLAEERGLTFIHAFDDP
FT                   LVVAGQGTVGLEILEDLPDVDTVVVPVGGGGLIAGIAIAVKAQKPGVRVVGVQPQEAPA
FT                   LARAFATGRLEPVVRARTIADGLAVKTPREMTFRLIQRYVDDMVTVTEEEIARAILLLL
FT                   ERAKLVAEGAGAAALAALLYGKVQHAGRVAVVVSGGNIDVNLLARIIERGLLEDGRLIR
FT                   IRTLVADRPGALQALLKVIADHRGNILAVYHDRLRHEVALGETEVELIIETRDAAHVDE
FT                   IRSALADRGYAVQGLEVQPAVRRP"
     MADGNASETV GHGPAAGGTG SGGAVIGGVE GGPGTGGARV DGAGGAVSGT GERPEAVVPA        60
     RAGGGQVPGG AGDPVDLEAI RRAAAAIAGF VHRTPLLGSA AFSELAGADV FLKLENLQKT       120
     GSFKVRGAFN RLSRLDAAAR ARGVICASAG NHAQGVALAG ARLGVPVTVV MPETAPTTKV       180
     VATRGYGAEV VLHGEGYDGA YDRACQLAEE RGLTFIHAFD DPLVVAGQGT VGLEILEDLP       240
     DVDTVVVPVG GGGLIAGIAI AVKAQKPGVR VVGVQPQEAP ALARAFATGR LEPVVRARTI       300
     ADGLAVKTPR EMTFRLIQRY VDDMVTVTEE EIARAILLLL ERAKLVAEGA GAAALAALLY       360
     GKVQHAGRVA VVVSGGNIDV NLLARIIERG LLEDGRLIRI RTLVADRPGA LQALLKVIAD       420
     HRGNILAVYH DRLRHEVALG ETEVELIIET RDAAHVDEIR SALADRGYAV QGLEVQPAVR       480
     RP                                                                      482
//

If you have problems or comments...

PBIL Back to PBIL home page