(data stored in ACNUC30630 zone)

EMBL: CP002344.PE95

CP002344.PE95        Location/Qualifiers
FT   CDS             95842..96306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0095"
FT                   /product="RDD domain containing protein"
FT                   /note="InterPro IPR010432; KEGG: tbd:Tbd_1995 putative
FT                   transmembrane protein; PFAM: RDD domain containing protein;
FT                   SPTR: Putative transmembrane protein; PFAM: RDD family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50220"
FT                   /db_xref="GOA:E6SL18"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL18"
FT                   /protein_id="ADU50220.1"
FT                   /translation="MPVDRLDPAPLPLRWAAGLVDLILLGAVGNLAGLTVLELAGARGG
FT                   WGTVGLAVLVVLATAAAYFAAGEGRWGTTLGKLAVGIRVVAGDGRPPGFRRALGRFAVR
FT                   LVGTALLGAGWWPALVGSPRERGRTWHDAVAGTRAVRWRPWQQATGAAAR"
     MPVDRLDPAP LPLRWAAGLV DLILLGAVGN LAGLTVLELA GARGGWGTVG LAVLVVLATA        60
     AAYFAAGEGR WGTTLGKLAV GIRVVAGDGR PPGFRRALGR FAVRLVGTAL LGAGWWPALV       120
     GSPRERGRTW HDAVAGTRAV RWRPWQQATG AAAR                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page