(data stored in ACNUC7421 zone)

EMBL: CP002355.PE10

CP002355.PE10        Location/Qualifiers
FT   CDS             complement(11037..12449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0010"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterPro IPR004358: IPR005467: IPR003661: IPR003594; KEGG:
FT                   tdn:Suden_1558 histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; SPTR: Histidine kinase; PFAM:
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;
FT                   His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32678"
FT                   /db_xref="GOA:E4TW62"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW62"
FT                   /protein_id="ADR32678.1"
FT                   /translation="MLRIHQLFFLNVLGLFVAALFVASLISYFTLKSMIINDSEERLIE
FT                   NINLLEPLLTSTNDFDRFVAQAAGKTFLRVTVIDENGNVMAESDADKTTMENHIGRVEV
FT                   MHAMTEPYGTAIRYSKTVKTDFIYVAHKIVTPERTFYIRLAMSLEGVMKHFYVLWIQLV
FT                   GGFGILVVIALLIAYNISKKARYDILQITRYLDEVSAKNYRAVLKPEYFREFLQISILL
FT                   KNLVKKLHNRDKQKRKHTAKLRLINKQQNDILSAISHEFKNPIAAIMGYAETLHDDLNI
FT                   DPKIREKFLDKILSNTQRVTLMLDRLALSVKLENNDLSIKPSSFNISDICHDSISILQA
FT                   KYPARSITYHGTAKTVFADKTMIELIITNLIDNALKYSDEEVTVTLTDNTLSVSDKGIG
FT                   IAQSELDKITSKFYRVQKNRWDNSMGLGLSIVSYILKLHDSELRIESILGIGSTFSFSL
FT                   ANLVEKKGPSKK"
     MLRIHQLFFL NVLGLFVAAL FVASLISYFT LKSMIINDSE ERLIENINLL EPLLTSTNDF        60
     DRFVAQAAGK TFLRVTVIDE NGNVMAESDA DKTTMENHIG RVEVMHAMTE PYGTAIRYSK       120
     TVKTDFIYVA HKIVTPERTF YIRLAMSLEG VMKHFYVLWI QLVGGFGILV VIALLIAYNI       180
     SKKARYDILQ ITRYLDEVSA KNYRAVLKPE YFREFLQISI LLKNLVKKLH NRDKQKRKHT       240
     AKLRLINKQQ NDILSAISHE FKNPIAAIMG YAETLHDDLN IDPKIREKFL DKILSNTQRV       300
     TLMLDRLALS VKLENNDLSI KPSSFNISDI CHDSISILQA KYPARSITYH GTAKTVFADK       360
     TMIELIITNL IDNALKYSDE EVTVTLTDNT LSVSDKGIGI AQSELDKITS KFYRVQKNRW       420
     DNSMGLGLSI VSYILKLHDS ELRIESILGI GSTFSFSLAN LVEKKGPSKK                  470
//

If you have problems or comments...

PBIL Back to PBIL home page