(data stored in ACNUC7421 zone)

EMBL: CP002355.PE101

CP002355.PE101       Location/Qualifiers
FT   CDS             98866..99471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0101"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="COGs: COG0237 Dephospho-CoA kinase; InterPro
FT                   IPR001977; KEGG: tdn:Suden_2047 dephospho-CoA kinase; PFAM:
FT                   Dephospho-CoA kinase; PRIAM: Dephospho-CoA kinase; SPTR:
FT                   Dephospho-CoA kinase; TIGRFAM: dephospho-CoA kinase; PFAM:
FT                   Dephospho-CoA kinase; TIGRFAM: dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32769"
FT                   /db_xref="GOA:E4TWT8"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT8"
FT                   /protein_id="ADR32769.1"
FT                   /translation="MAFEYAIALTGGIATGKSTVASLLGLNGLRIIDADTIAHRILDEN
FT                   SAWVSERFGSEFVKNGKVDRPSLGKIVFADAQAKKELENFLHPKIRAAIEEESEKQDRL
FT                   KYPYLIDIPLFFETASYPIKNSVVVYTPKALQLERFMKRNGFSEEESLRRIESQMDIEE
FT                   KKKRATWVIDNSSNLKHLQCECEQFVESIKALYPAPKV"
     MAFEYAIALT GGIATGKSTV ASLLGLNGLR IIDADTIAHR ILDENSAWVS ERFGSEFVKN        60
     GKVDRPSLGK IVFADAQAKK ELENFLHPKI RAAIEEESEK QDRLKYPYLI DIPLFFETAS       120
     YPIKNSVVVY TPKALQLERF MKRNGFSEEE SLRRIESQMD IEEKKKRATW VIDNSSNLKH       180
     LQCECEQFVE SIKALYPAPK V                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page