(data stored in ACNUC7421 zone)

EMBL: CP002355.PE103

CP002355.PE103       Location/Qualifiers
FT   CDS             complement(100517..101584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0103"
FT                   /product="bacterial peptide chain release factor 1 (bRF-1)"
FT                   /note="COGs: COG0216 Protein chain release factor A;
FT                   InterPro IPR000352: IPR004373: IPR005139; KEGG:
FT                   tdn:Suden_2045 peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; SPTR:
FT                   Peptide chain release factor 1; TIGRFAM: peptide chain
FT                   release factor 1; PFAM: PCRF domain; RF-1 domain; TIGRFAM:
FT                   peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32771"
FT                   /db_xref="GOA:E4TWU0"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU0"
FT                   /protein_id="ADR32771.1"
FT                   /translation="MLSDKLTPFINRYNELTELLSSPDIGNDIKRMTELSKEQSSIQAI
FT                   VNKATEYKKLLEDIEENKSLAFDAELGELAKEELRTLEPMVEPLEEEIKKLLIPADPND
FT                   KRNIYIELRAGTGGDEAAIFVGDLFNAYVRYADVKGWKIELMSSSPSDAGGYKEIIALI
FT                   KGEQVYSRLKYEAGTHRVQRVPATESQGRVHTSAITVAVMPEVDDVEVTINENDLKIDV
FT                   MRSSGSGGQSVNTTDSAVRITHLPTGIVVTNQDEKSQHKNKDKAMKILKARIYEMQMEE
FT                   AKVKEMSERKEQVGTGDRSGRIRTYNYPQNRISDHRINLTLYRLDEIMQGGLMDDIIEP
FT                   LIADAQAQIMERAGL"
     MLSDKLTPFI NRYNELTELL SSPDIGNDIK RMTELSKEQS SIQAIVNKAT EYKKLLEDIE        60
     ENKSLAFDAE LGELAKEELR TLEPMVEPLE EEIKKLLIPA DPNDKRNIYI ELRAGTGGDE       120
     AAIFVGDLFN AYVRYADVKG WKIELMSSSP SDAGGYKEII ALIKGEQVYS RLKYEAGTHR       180
     VQRVPATESQ GRVHTSAITV AVMPEVDDVE VTINENDLKI DVMRSSGSGG QSVNTTDSAV       240
     RITHLPTGIV VTNQDEKSQH KNKDKAMKIL KARIYEMQME EAKVKEMSER KEQVGTGDRS       300
     GRIRTYNYPQ NRISDHRINL TLYRLDEIMQ GGLMDDIIEP LIADAQAQIM ERAGL            355
//

If you have problems or comments...

PBIL Back to PBIL home page