(data stored in ACNUC7421 zone)

EMBL: CP002355.PE105

CP002355.PE105       Location/Qualifiers
FT   CDS             102045..103385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0105"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="COGs: COG1109 Phosphomannomutase; InterProIPR016066:
FT                   IPR006352: IPR005841: IPR005844: IPR 005845: IPR005846:
FT                   IPR005843; KEGG: tdn:Suden_2039 phosphoglucosamine mutase;
FT                   PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase; SPTR:
FT                   Phosphoglucosamine mutase; TIGRFAM: phosphoglucosamine
FT                   mutase; PFAM: Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain II;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain III; Phosphoglucomutase/phosphomannomutase,
FT                   C-terminal domain; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain I; TIGRFAM: phosphoglucosamine
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32773"
FT                   /db_xref="GOA:E4TWU2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU2"
FT                   /protein_id="ADR32773.1"
FT                   /translation="MKLFGTDGVRGEAGSFLTAELAMRVAMAAGIYFSEHARTKKILLG
FT                   KDTRKSGYMIENAIVSGLTAVGYDVVQIGPMPTPAIAFLTLNMRCDAGIMISASHNPFE
FT                   DNGIKFFDAHGNKLSEEIEAQIEAIAHDKARLEEGQVTGKNIGSAKRIDDVIGRYIVQL
FT                   KNSFSRELTLQGLRIVLDTANGAGYKVGPTVLEELGAEVIVLHDKPNGFNINEGCGAMH
FT                   TKDLREAVKQYRADIGLALDGDADRLIVVDENGDEVDGDQILGSLGLFLNKNGQLKGGG
FT                   IVATVMSNQALEDTMNENGLKLFRSNVGDKYVLEVMRENGINFGGEQSGHIILHDYAKT
FT                   GDGLVSALQILALLLTSGQKASKVLRPFKLYPQKLVNIKVKTKKPLDQIEGLSEELAKI
FT                   ESAHMRHLIRYSGTENKLRILLEGKDAKVMEKSMEHLVSFFEKALNG"
     MKLFGTDGVR GEAGSFLTAE LAMRVAMAAG IYFSEHARTK KILLGKDTRK SGYMIENAIV        60
     SGLTAVGYDV VQIGPMPTPA IAFLTLNMRC DAGIMISASH NPFEDNGIKF FDAHGNKLSE       120
     EIEAQIEAIA HDKARLEEGQ VTGKNIGSAK RIDDVIGRYI VQLKNSFSRE LTLQGLRIVL       180
     DTANGAGYKV GPTVLEELGA EVIVLHDKPN GFNINEGCGA MHTKDLREAV KQYRADIGLA       240
     LDGDADRLIV VDENGDEVDG DQILGSLGLF LNKNGQLKGG GIVATVMSNQ ALEDTMNENG       300
     LKLFRSNVGD KYVLEVMREN GINFGGEQSG HIILHDYAKT GDGLVSALQI LALLLTSGQK       360
     ASKVLRPFKL YPQKLVNIKV KTKKPLDQIE GLSEELAKIE SAHMRHLIRY SGTENKLRIL       420
     LEGKDAKVME KSMEHLVSFF EKALNG                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page