(data stored in ACNUC7421 zone)

EMBL: CP002355.PE107

CP002355.PE107       Location/Qualifiers
FT   CDS             104046..105854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0107"
FT                   /product="Ser-tRNA(Thr) hydrolase; threonyl-tRNA
FT                   synthetase"
FT                   /EC_number="3.1.1.-"
FT                   /EC_number="6.1.1.3"
FT                   /note="COGs: COG0441 Threonyl-tRNA synthetase;
FT                   InterProIPR002320: IPR018158: IPR006195: IPR012947: IPR
FT                   002314: IPR004154; KEGG: tdn:Suden_0066 threonyl-tRNA
FT                   synthetase; PFAM: tRNA synthetase class II (G H P and S);
FT                   Threonyl/alanyl tRNA synthetase SAD; Anticodon-binding
FT                   domain protein; SPTR: Ser-tRNA(Thr) hydrolase /
FT                   threonyl-tRNA synthetase; TIGRFAM: threonyl-tRNA
FT                   synthetase; PFAM: Anticodon binding domain; Threonyl and
FT                   Alanyl tRNA synthetase second additional domain; tRNA
FT                   synthetase class II core domain (G, H, P, S and T);
FT                   TIGRFAM: threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32775"
FT                   /db_xref="GOA:E4TWU4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU4"
FT                   /protein_id="ADR32775.1"
FT                   /translation="MDIIAIKHNDQIVDLQTAGALGITGEEIAYDNSPDALEVIRHSCA
FT                   HLMAEAIKALYTDAKFFVGPTVKEGFYYDFKVNETIGEDDLKTIEKKMLDIAKGKEKIE
FT                   RYEITKNEARAKFANDHLKQAVMDRIPSDTVTIYKQGEFEDLCRGPHLPSVGLLRYFKL
FT                   TKISGAYLGGDSKNEMLTRIYGIAFADKESLKAYLDQMAEAEKRDHRKIGAEMKLFTFR
FT                   EEVGAGFPIWLPAGARMRSRLEQLLFKAHRKRGYEPVRGPEMLRSDLWKVSGHYQNYGE
FT                   NMYFTHIDELEFGVKPMNCVGHIKVYEHDLHSYRDLPLKYFEYGVVHRHEMTGALHGLF
FT                   RVREFTQDDAHIFCTADQIEQQIIEVVDFVDKIMKTFEFNYKMMISTKPEKAVGDDAVW
FT                   EISTNALKTAMDKNNLSYEIDEGGGAFYGPKIDIKITDAIGREWQCGTIQLDFNLPARF
FT                   ELEYNGEENAKIQPVMIHRAILGSFERFVGILTEHYAGEFPMFIAPTQVAIVPIAPTHE
FT                   AYARELADKLIDMGADFEIFDKNESLNKRIRTAEKGRVPMIIVLGDEEVANKSIAVRDR
FT                   RSREQYNLSEEDFISLVKQKINEVHF"
     MDIIAIKHND QIVDLQTAGA LGITGEEIAY DNSPDALEVI RHSCAHLMAE AIKALYTDAK        60
     FFVGPTVKEG FYYDFKVNET IGEDDLKTIE KKMLDIAKGK EKIERYEITK NEARAKFAND       120
     HLKQAVMDRI PSDTVTIYKQ GEFEDLCRGP HLPSVGLLRY FKLTKISGAY LGGDSKNEML       180
     TRIYGIAFAD KESLKAYLDQ MAEAEKRDHR KIGAEMKLFT FREEVGAGFP IWLPAGARMR       240
     SRLEQLLFKA HRKRGYEPVR GPEMLRSDLW KVSGHYQNYG ENMYFTHIDE LEFGVKPMNC       300
     VGHIKVYEHD LHSYRDLPLK YFEYGVVHRH EMTGALHGLF RVREFTQDDA HIFCTADQIE       360
     QQIIEVVDFV DKIMKTFEFN YKMMISTKPE KAVGDDAVWE ISTNALKTAM DKNNLSYEID       420
     EGGGAFYGPK IDIKITDAIG REWQCGTIQL DFNLPARFEL EYNGEENAKI QPVMIHRAIL       480
     GSFERFVGIL TEHYAGEFPM FIAPTQVAIV PIAPTHEAYA RELADKLIDM GADFEIFDKN       540
     ESLNKRIRTA EKGRVPMIIV LGDEEVANKS IAVRDRRSRE QYNLSEEDFI SLVKQKINEV       600
     HF                                                                      602
//

If you have problems or comments...

PBIL Back to PBIL home page