(data stored in ACNUC7421 zone)

EMBL: CP002355.PE108

CP002355.PE108       Location/Qualifiers
FT   CDS             105851..106381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0108"
FT                   /product="bacterial translation initiation factor 3
FT                   (bIF-3)"
FT                   /note="COGs: COG0290 Translation initiation factor 3
FT                   (IF-3); InterPro IPR019813: IPR001288: IPR019814:
FT                   IPR019815; KEGG: tdn:Suden_0067 translation initiation
FT                   factor IF-3; PFAM: Translation initiation factor 3-like;
FT                   SPTR: Translation initiation factor IF-3; TIGRFAM:
FT                   translation initiation factor IF-3; PFAM: Translation
FT                   initiation factor IF-3, C-terminal domain; Translation
FT                   initiation factor IF-3, N-terminal domain; TIGRFAM:
FT                   translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32776"
FT                   /db_xref="GOA:E4TWU5"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU5"
FT                   /protein_id="ADR32776.1"
FT                   /translation="MIKKQDRVLMNEDIRVPEVRCVVDGGEALGIISINEAMNKANEMG
FT                   LDLVLISPDAKPPVAKIMDYGKFHYQEEKKKKEARKKQTKVEVKEIKLSVKIADNDVGY
FT                   KVKHAREFLEEGKHVHFRVFLRGREMAHPESAVAVLQRVWPMVEDIGTMYKAPQMEGRY
FT                   CNMMIHPKKDDKK"
     MIKKQDRVLM NEDIRVPEVR CVVDGGEALG IISINEAMNK ANEMGLDLVL ISPDAKPPVA        60
     KIMDYGKFHY QEEKKKKEAR KKQTKVEVKE IKLSVKIADN DVGYKVKHAR EFLEEGKHVH       120
     FRVFLRGREM AHPESAVAVL QRVWPMVEDI GTMYKAPQME GRYCNMMIHP KKDDKK           176
//

If you have problems or comments...

PBIL Back to PBIL home page