(data stored in ACNUC7421 zone)

EMBL: CP002355.PE11

CP002355.PE11        Location/Qualifiers
FT   CDS             complement(12443..13117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0011"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789: IPR001867; KEGG: tdn:Suden_1559
FT                   two component transcriptional regulator; PFAM: response
FT                   regulator receiver; transcriptional regulator
FT                   domain-containing protein; SMART: response regulator
FT                   receiver; SPTR: Two component transcriptional regulator,
FT                   winged helix family; PFAM: Response regulator receiver
FT                   domain; Transcriptional regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32679"
FT                   /db_xref="GOA:E4TW63"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW63"
FT                   /protein_id="ADR32679.1"
FT                   /translation="MNALILIVEDEQDILELMEYHLTKEGFETIGFLNTKHVNNALEEE
FT                   NVDLILMDRNLPGAEGSEFVESLRKRGMQTPVIFVSAKNKDEDIEQGFERGGDDYIAKP
FT                   FSMKELILRVKAVLRRTKKLSNEGNLSYRDISLNLAARTVFIESNPIELTKLEFDLLHA
FT                   LIVNENVVLERDYLLENVWGGDEVYQDRTVNVAINRLKEKIDPDKSKEYIKTVRGVGYT
FT                   LC"
     MNALILIVED EQDILELMEY HLTKEGFETI GFLNTKHVNN ALEEENVDLI LMDRNLPGAE        60
     GSEFVESLRK RGMQTPVIFV SAKNKDEDIE QGFERGGDDY IAKPFSMKEL ILRVKAVLRR       120
     TKKLSNEGNL SYRDISLNLA ARTVFIESNP IELTKLEFDL LHALIVNENV VLERDYLLEN       180
     VWGGDEVYQD RTVNVAINRL KEKIDPDKSK EYIKTVRGVG YTLC                        224
//

If you have problems or comments...

PBIL Back to PBIL home page