(data stored in ACNUC7421 zone)

EMBL: CP002355.PE110

CP002355.PE110       Location/Qualifiers
FT   CDS             106863..107216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0110"
FT                   /product="LSU ribosomal protein L20P"
FT                   /note="COGs: COG0292 Ribosomal protein L20; InterPro
FT                   IPR005813; KEGG: ccv:CCV52592_0347 50S ribosomal protein
FT                   L20; PFAM: ribosomal protein L20; SPTR: 50S ribosomal
FT                   protein L20; TIGRFAM: ribosomal protein L20; PFAM:
FT                   Ribosomal protein L20; TIGRFAM: ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32778"
FT                   /db_xref="GOA:E4TWU7"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU7"
FT                   /protein_id="ADR32778.1"
FT                   /translation="MPRVKTGVVRRRRHKKVLKLARGFYSARHKHFRKAKEQLERSLVY
FT                   AFRDRKQKKREFRKLWIIRINAACRLNGMSYSVFMNGLKRANIELDRKILADMAMNDAA
FT                   AFTALTTQAKAAL"
     MPRVKTGVVR RRRHKKVLKL ARGFYSARHK HFRKAKEQLE RSLVYAFRDR KQKKREFRKL        60
     WIIRINAACR LNGMSYSVFM NGLKRANIEL DRKILADMAM NDAAAFTALT TQAKAAL          117
//

If you have problems or comments...

PBIL Back to PBIL home page