(data stored in ACNUC7421 zone)

EMBL: CP002355.PE111

CP002355.PE111       Location/Qualifiers
FT   CDS             complement(107305..107547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0111"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vvy:VVA1079 membrane-fusion protein; SPTR:
FT                   Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32779"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU8"
FT                   /protein_id="ADR32779.1"
FT                   /translation="MKKNLFFGLIAAALLLSGCADKQISINGMICPAGKTEDRIMADFQ
FT                   ECRYYDLKAAGEASKAPITVECQKCLESKGYKIEQ"
     MKKNLFFGLI AAALLLSGCA DKQISINGMI CPAGKTEDRI MADFQECRYY DLKAAGEASK        60
     APITVECQKC LESKGYKIEQ                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page