(data stored in ACNUC7421 zone)

EMBL: CP002355.PE112

CP002355.PE112       Location/Qualifiers
FT   CDS             complement(107544..108170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0112"
FT                   /product="thymidylate synthase (FAD)"
FT                   /EC_number="2.1.1.148"
FT                   /note="COGs: COG1351 alternative thymidylate synthase;
FT                   InterPro IPR003669; KEGG: sdl:Sdel_0001 thymidylate
FT                   synthase, flavin-dependent; PFAM: thymidylate synthase
FT                   complementing protein ThyX; PRIAM: Thymidylate synthase
FT                   (FAD); SPTR: Thymidylate synthase, flavin-dependent;
FT                   TIGRFAM: thymidylate synthase, flavin-dependent; PFAM:
FT                   Thymidylate synthase complementing protein; TIGRFAM:
FT                   thymidylate synthase, flavin-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32780"
FT                   /db_xref="GOA:E4TWU9"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU9"
FT                   /protein_id="ADR32780.1"
FT                   /translation="MKVTLQHHTPLVICSDAIRTCWQSFDKSDNGGEKDRELIDRVGNK
FT                   FKHASTLEHIVYNFYVEGISRALLQELARHRMASLSVKSTRYTLKELKDEEPFSIDHKE
FT                   RAAKYLVMTDVEMVDEMSIRALENLRAVLVAGISNDRAKYCLPESYKTELAWSINARSL
FT                   QNFISLRSDKAALWEIRDLAHAVYSALPEDHRYLFENSLKEEHTS"
     MKVTLQHHTP LVICSDAIRT CWQSFDKSDN GGEKDRELID RVGNKFKHAS TLEHIVYNFY        60
     VEGISRALLQ ELARHRMASL SVKSTRYTLK ELKDEEPFSI DHKERAAKYL VMTDVEMVDE       120
     MSIRALENLR AVLVAGISND RAKYCLPESY KTELAWSINA RSLQNFISLR SDKAALWEIR       180
     DLAHAVYSAL PEDHRYLFEN SLKEEHTS                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page