(data stored in ACNUC7421 zone)

EMBL: CP002355.PE114

CP002355.PE114       Location/Qualifiers
FT   CDS             complement(110507..111286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0114"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COGs: COG0030 Dimethyladenosine transferase (rRNA
FT                   methylation); InterPro IPR011530: IPR001737: IPR020598;
FT                   KEGG: tdn:Suden_2090 dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; SMART:
FT                   Ribosomal RNA adenine methylase transferase-like; SPTR:
FT                   Ribosomal RNA small subunit methyltransferase A; TIGRFAM:
FT                   dimethyladenosine transferase; PFAM: Ribosomal RNA adenine
FT                   dimethylase; TIGRFAM: dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32782"
FT                   /db_xref="GOA:E4TWV1"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV1"
FT                   /protein_id="ADR32782.1"
FT                   /translation="MQKDRAAIAKKKFGQNFLKDEAVLAQIIQSMPDTPHRIAEIGPGL
FT                   GDLTKYLVDVKSVTAFEVDTDLCKHLTHQFADAIATNALTLRCGDVLEHWKSELLDEPY
FT                   DLVANLPYYIATNIILKALADPACRNLLVMIQREVAEKFSAAPGERAFGALSVIAQSVG
FT                   EAEIVLHVPPTAFEPAPKVDSCVLLISKRTNRNDEGFEDFLRTAFTQPRKTLHKNLSSR
FT                   YDGTVLSQAFETLELERSIRPHQLDTSDFHRLYTLIK"
     MQKDRAAIAK KKFGQNFLKD EAVLAQIIQS MPDTPHRIAE IGPGLGDLTK YLVDVKSVTA        60
     FEVDTDLCKH LTHQFADAIA TNALTLRCGD VLEHWKSELL DEPYDLVANL PYYIATNIIL       120
     KALADPACRN LLVMIQREVA EKFSAAPGER AFGALSVIAQ SVGEAEIVLH VPPTAFEPAP       180
     KVDSCVLLIS KRTNRNDEGF EDFLRTAFTQ PRKTLHKNLS SRYDGTVLSQ AFETLELERS       240
     IRPHQLDTSD FHRLYTLIK                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page