(data stored in ACNUC7421 zone)

EMBL: CP002355.PE115

CP002355.PE115       Location/Qualifiers
FT   CDS             111443..112204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0115"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /EC_number="4.1.3.-"
FT                   /note="COGs: COG0107 Imidazoleglycerol-phosphate synthase;
FT                   InterPro IPR004651: IPR006062; KEGG: tdn:Suden_2091
FT                   imidazole glycerol phosphate synthase subunit HisF; PFAM:
FT                   histidine biosynthesis protein; SPTR: Imidazole glycerol
FT                   phosphate synthase subunit hisF; TIGRFAM: imidazoleglycerol
FT                   phosphate synthase, cyclase subunit; PFAM: Histidine
FT                   biosynthesis protein; TIGRFAM: imidazoleglycerol phosphate
FT                   synthase, cyclase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32783"
FT                   /db_xref="GOA:E4TWV2"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV2"
FT                   /protein_id="ADR32783.1"
FT                   /translation="MDNFFAKRIIPCLDVKDGRVVKGVNFVGLKDAGDPVEVAKRYNEE
FT                   GADELTFLDITASHEERDTIVHIVEQVAKEVFIPLTVGGGIRKLDDIYRLLAVGCDKVS
FT                   VNSAAIKRPELIDEGAKRFGSQCIVVAIDVKRTGNQYNVYLNGGRVDTGINALEWAKEV
FT                   VDRGAGEILLTSMDADGTKAGFDLSITEQISRAVNVPVIASGGAGTMEHIKEAFEHGAD
FT                   AALAASIFHYKEIDIMDLKRYLSANGIPVRL"
     MDNFFAKRII PCLDVKDGRV VKGVNFVGLK DAGDPVEVAK RYNEEGADEL TFLDITASHE        60
     ERDTIVHIVE QVAKEVFIPL TVGGGIRKLD DIYRLLAVGC DKVSVNSAAI KRPELIDEGA       120
     KRFGSQCIVV AIDVKRTGNQ YNVYLNGGRV DTGINALEWA KEVVDRGAGE ILLTSMDADG       180
     TKAGFDLSIT EQISRAVNVP VIASGGAGTM EHIKEAFEHG ADAALAASIF HYKEIDIMDL       240
     KRYLSANGIP VRL                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page