(data stored in ACNUC7421 zone)

EMBL: CP002355.PE116

CP002355.PE116       Location/Qualifiers
FT   CDS             112201..112737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0116"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_2092 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Phosphorylase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32784"
FT                   /db_xref="GOA:E4TWV3"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV3"
FT                   /protein_id="ADR32784.1"
FT                   /translation="MILCAGNNETFDFATPIGVGLIDSAINLTRHALVHKPEFILFVGS
FT                   AGSYGEHKIHEIIESKTAANIELGFLDKSAYTPIDNVVSAQTETIKDVIVNSSNYITTS
FT                   EKAMEQMRGLGMGIENMEFFSVMRVAQIFGIPAGGVFCITNYCDTNAHRDFISNHGFAK
FT                   VLLREHLVNKGMIRG"
     MILCAGNNET FDFATPIGVG LIDSAINLTR HALVHKPEFI LFVGSAGSYG EHKIHEIIES        60
     KTAANIELGF LDKSAYTPID NVVSAQTETI KDVIVNSSNY ITTSEKAMEQ MRGLGMGIEN       120
     MEFFSVMRVA QIFGIPAGGV FCITNYCDTN AHRDFISNHG FAKVLLREHL VNKGMIRG         178
//

If you have problems or comments...

PBIL Back to PBIL home page