(data stored in ACNUC7421 zone)

EMBL: CP002355.PE117

CP002355.PE117       Location/Qualifiers
FT   CDS             112730..113794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0117"
FT                   /product="23S rRNA m(2)A-2503 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COGs: COG0820 Fe-S-cluster redox enzyme; InterPro
FT                   IPR004383: IPR007197; KEGG: tdn:Suden_2093 ribosomal RNA
FT                   large subunit methyltransferase N; PFAM: Radical SAM domain
FT                   protein; SPTR: Ribosomal RNA large subunit
FT                   methyltransferase N; TIGRFAM: radical SAM enzyme, Cfr
FT                   family; PFAM: Radical SAM superfamily; TIGRFAM: radical SAM
FT                   enzyme, Cfr family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32785"
FT                   /db_xref="GOA:E4TWV4"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV4"
FT                   /protein_id="ADR32785.1"
FT                   /translation="MGKLCILDYTKAELAGMVKPSFRAKQIWGWIYHQYATSFETMQNL
FT                   PKTMREELAQTYEIMPLKIARKECSTDGTIKYLFELSDGKTVETVWLKMKDESIDEEGN
FT                   IEHEARYTVCVSTQVGCKVGCSFCLTAKGGFTRDLTAGEIVAQVLAVKMDNNLAAHRRL
FT                   NIVYMGMGEPLDNLDNLAKAITILKDEEGLSISGKRQTVSTSGLSTKIDKLGEMDLGVH
FT                   IAISLHAVDDELRTELIPMNKAYNIASIIDAVKRFPIDTRKRVMFEYLVIKNKNDDLGS
FT                   AKKLVKLLHGIKAKVNLIYFNPYPGSDYQRPSREDMVAFQEYLIKHGVLCTIRDSKGLD
FT                   ISAACGQLKEKSLT"
     MGKLCILDYT KAELAGMVKP SFRAKQIWGW IYHQYATSFE TMQNLPKTMR EELAQTYEIM        60
     PLKIARKECS TDGTIKYLFE LSDGKTVETV WLKMKDESID EEGNIEHEAR YTVCVSTQVG       120
     CKVGCSFCLT AKGGFTRDLT AGEIVAQVLA VKMDNNLAAH RRLNIVYMGM GEPLDNLDNL       180
     AKAITILKDE EGLSISGKRQ TVSTSGLSTK IDKLGEMDLG VHIAISLHAV DDELRTELIP       240
     MNKAYNIASI IDAVKRFPID TRKRVMFEYL VIKNKNDDLG SAKKLVKLLH GIKAKVNLIY       300
     FNPYPGSDYQ RPSREDMVAF QEYLIKHGVL CTIRDSKGLD ISAACGQLKE KSLT             354
//

If you have problems or comments...

PBIL Back to PBIL home page