(data stored in ACNUC7421 zone)

EMBL: CP002355.PE118

CP002355.PE118       Location/Qualifiers
FT   CDS             complement(113964..114659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0118"
FT                   /product="Nucleoside-specific channel-forming protein, Tsx"
FT                   /note="COGs: COG3248 Nucleoside-binding outer membrane
FT                   protein; InterPro IPR018013; KEGG: afw:Anae109_0194
FT                   hypothetical protein; PFAM: Nucleoside-specific
FT                   channel-forming protein, Tsx-like; SPTR: Putative
FT                   uncharacterized protein; PFAM: Nucleoside-specific
FT                   channel-forming protein, Tsx"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32786"
FT                   /db_xref="GOA:E4TWV5"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV5"
FT                   /protein_id="ADR32786.1"
FT                   /translation="MKRLLFASLITAAQLSAFSATNLQYLYGKFEGPTFLDTQSGNKHT
FT                   ITAEHYRTWEYGDLFAFADYVYAPNGLRFSGDKNDLYGEISPRISFNKIAGIPVSDGFI
FT                   KEWYAAFQYNGSDTYHAWLYGFGTDMNVPGFSVFGLNLYRKVQNIGNETYQLSANYYAP
FT                   LGEKWHFEGFTDWTTCDFLSQNQLLFNLNSVFGIKEGKLEIGTEWHYYHENSYRNDNDV
FT                   FQAMLKYSW"
     MKRLLFASLI TAAQLSAFSA TNLQYLYGKF EGPTFLDTQS GNKHTITAEH YRTWEYGDLF        60
     AFADYVYAPN GLRFSGDKND LYGEISPRIS FNKIAGIPVS DGFIKEWYAA FQYNGSDTYH       120
     AWLYGFGTDM NVPGFSVFGL NLYRKVQNIG NETYQLSANY YAPLGEKWHF EGFTDWTTCD       180
     FLSQNQLLFN LNSVFGIKEG KLEIGTEWHY YHENSYRNDN DVFQAMLKYS W                231
//

If you have problems or comments...

PBIL Back to PBIL home page