(data stored in ACNUC7421 zone)

EMBL: CP002355.PE119

CP002355.PE119       Location/Qualifiers
FT   CDS             complement(114637..115476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0119"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG0739 Membrane protein related to
FT                   metalloendopeptidase; InterPro IPR010916: IPR016047; KEGG:
FT                   cju:C8J_1178 peptidase, M23/M37 family; PFAM: Peptidase
FT                   M23; SPTR: Peptidase; PFAM: Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32787"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV6"
FT                   /protein_id="ADR32787.1"
FT                   /translation="MRFLLILWLGFLALWGAEGFNGKSLIIPLPSPSGTVIMSDRNISV
FT                   LLHPADKTKGIAVIPIDYYTPAGDINLTWIAPGNESFFSIHIQEADYPTETLSVDPALV
FT                   TPPPEAMEQIAAEKAQAEAIYGHFTPIRYWNKAFVKPIDSNITSEYGSARTYNGSLKSY
FT                   HGGVDFRARTPIPIVAANDGIVVLVQERYYSGGTIIIDHGEGIYSCYFHLSRFDVNVGD
FT                   RIERGQPIALSGESGRITGPHLHFGMMVHGIQSDPLDLISQFNALISKDTDETLTLR"
     MRFLLILWLG FLALWGAEGF NGKSLIIPLP SPSGTVIMSD RNISVLLHPA DKTKGIAVIP        60
     IDYYTPAGDI NLTWIAPGNE SFFSIHIQEA DYPTETLSVD PALVTPPPEA MEQIAAEKAQ       120
     AEAIYGHFTP IRYWNKAFVK PIDSNITSEY GSARTYNGSL KSYHGGVDFR ARTPIPIVAA       180
     NDGIVVLVQE RYYSGGTIII DHGEGIYSCY FHLSRFDVNV GDRIERGQPI ALSGESGRIT       240
     GPHLHFGMMV HGIQSDPLDL ISQFNALISK DTDETLTLR                              279
//

If you have problems or comments...

PBIL Back to PBIL home page