(data stored in ACNUC7421 zone)

EMBL: CP002355.PE12

CP002355.PE12        Location/Qualifiers
FT   CDS             complement(13251..13922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0012"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="COGs: COG0704 Phosphate uptake regulator; InterPro
FT                   IPR008170; KEGG: tdn:Suden_1888 phosphate uptake
FT                   regulator-like; PFAM: PhoU family protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: PhoU domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32680"
FT                   /db_xref="GOA:E4TW64"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW64"
FT                   /protein_id="ADR32680.1"
FT                   /translation="MLPRYENKLNEIRGMISVMLSQIIQSSEETLKAFETDNAELYEIS
FT                   RTYIKNIQVDANKIDNEIIKTFALFGPEADELRLLVAYLKMTNEIDRIGDGLKKYSKRL
FT                   HDHCMGGCDMSVLTNAIVQLHKTTINALQYISECLNNIDSCDADDTYRKVMVEESKNDD
FT                   LFSLMEKELLNLIIDANELAVEYVRVLGTLRKLERIGDRTVNIASLMLYAQKGGELNLH
FT                   N"
     MLPRYENKLN EIRGMISVML SQIIQSSEET LKAFETDNAE LYEISRTYIK NIQVDANKID        60
     NEIIKTFALF GPEADELRLL VAYLKMTNEI DRIGDGLKKY SKRLHDHCMG GCDMSVLTNA       120
     IVQLHKTTIN ALQYISECLN NIDSCDADDT YRKVMVEESK NDDLFSLMEK ELLNLIIDAN       180
     ELAVEYVRVL GTLRKLERIG DRTVNIASLM LYAQKGGELN LHN                         223
//

If you have problems or comments...

PBIL Back to PBIL home page