(data stored in ACNUC7421 zone)

EMBL: CP002355.PE121

CP002355.PE121       Location/Qualifiers
FT   CDS             116499..118949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0121"
FT                   /product="diguanylate cyclase/phosphodiesterase with GAF
FT                   sensor"
FT                   /note="COGs: COG2200 FOG: EAL domain; InterPro IPR001633:
FT                   IPR000160: IPR003018; KEGG: hna:Hneap_1816 diguanylate
FT                   cyclase/phosphodiesterase with GAF sensor; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; GAF domain
FT                   protein; SMART: EAL domain protein; GGDEF domain containing
FT                   protein; SPTR: Diguanylate cyclase/phosphodiesterase with
FT                   GAF sensor; PFAM: EAL domain; GGDEF domain; TIGRFAM:
FT                   diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32789"
FT                   /db_xref="GOA:E4TWV8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV8"
FT                   /protein_id="ADR32789.1"
FT                   /translation="MKLQRFNFLNLAVLFLLIGILSSSFYTIERNGMLNYLADGVNQSL
FT                   FRLEEDIQKTLQQDHLENVQALLDQGSAINSGIRILSVSLDGHTIAVSSSRSLIGKVIE
FT                   GEYLPLTQISEGLVENESLQYESEVTYFSGATKKRALLLVDLDKAYIFERLNNIAMFYA
FT                   LALFLGLGATALALLVGVRKLIIKPLERIAQRAQNQDIIAEKHLIEELSILDQTLCNSF
FT                   HSMQVQQEHLKEALDESLYLDGILRTVADINQLLITAKDVDELLMNSCLRLAEHPGYEL
FT                   CYIALKEGESLVVQAYSNDPTEYLHPKMKIPTEDLTDPTVRAMKEMSTVIIDHLEYENS
FT                   FGPWRFIAETGLYGSVISLPLISAIDALPLGVITLYTKYSEGFESKEVSMLEELAGDIG
FT                   FAIRSFTQREQLKYYLTTDSNTDLPNRFSLVEVLSRESMYGLAIINIDRFGDINEVYGV
FT                   SIGDAVLSQYGHWLRAKIASWKNIELFKLGSDEYALVATQCNDLKLFTDLLENLISTTQ
FT                   KEVFRVEGIEIVLTITVGVAKSTEQVLEHATAALKQAKRNRHSLEIFSSESKQEQENNI
FT                   AWYKRIKEAIEDSRIVPYFQPIVDNESGKIIKYEALIRLVDVDGSIVSPYQFLEIAKKT
FT                   KLYPELTKMMITKVVKLFKDSAFPVSLNLSTQDLTNHDLADFLEETIHENGVGQLMIFE
FT                   ILESEGIENYSSVSEFVDRFKAIGCRFAIDDFGSGYSNFDHLLKLNIDTLKIDGSLIKN
FT                   LPHNRNAQIFVKHICDFAHEMGIKVIAEFVANEAIFHQVKAIGIDASQGYYFYEPSPIV
FT                   VGGN"
     MKLQRFNFLN LAVLFLLIGI LSSSFYTIER NGMLNYLADG VNQSLFRLEE DIQKTLQQDH        60
     LENVQALLDQ GSAINSGIRI LSVSLDGHTI AVSSSRSLIG KVIEGEYLPL TQISEGLVEN       120
     ESLQYESEVT YFSGATKKRA LLLVDLDKAY IFERLNNIAM FYALALFLGL GATALALLVG       180
     VRKLIIKPLE RIAQRAQNQD IIAEKHLIEE LSILDQTLCN SFHSMQVQQE HLKEALDESL       240
     YLDGILRTVA DINQLLITAK DVDELLMNSC LRLAEHPGYE LCYIALKEGE SLVVQAYSND       300
     PTEYLHPKMK IPTEDLTDPT VRAMKEMSTV IIDHLEYENS FGPWRFIAET GLYGSVISLP       360
     LISAIDALPL GVITLYTKYS EGFESKEVSM LEELAGDIGF AIRSFTQREQ LKYYLTTDSN       420
     TDLPNRFSLV EVLSRESMYG LAIINIDRFG DINEVYGVSI GDAVLSQYGH WLRAKIASWK       480
     NIELFKLGSD EYALVATQCN DLKLFTDLLE NLISTTQKEV FRVEGIEIVL TITVGVAKST       540
     EQVLEHATAA LKQAKRNRHS LEIFSSESKQ EQENNIAWYK RIKEAIEDSR IVPYFQPIVD       600
     NESGKIIKYE ALIRLVDVDG SIVSPYQFLE IAKKTKLYPE LTKMMITKVV KLFKDSAFPV       660
     SLNLSTQDLT NHDLADFLEE TIHENGVGQL MIFEILESEG IENYSSVSEF VDRFKAIGCR       720
     FAIDDFGSGY SNFDHLLKLN IDTLKIDGSL IKNLPHNRNA QIFVKHICDF AHEMGIKVIA       780
     EFVANEAIFH QVKAIGIDAS QGYYFYEPSP IVVGGN                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page