(data stored in ACNUC7421 zone)

EMBL: CP002355.PE122

CP002355.PE122       Location/Qualifiers
FT   CDS             118952..120172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0122"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="COGs: COG3434 signal transduction protein containing
FT                   EAL and modified HD-GYP domains; InterPro IPR014408:
FT                   IPR001633: IPR013976; KEGG: ddf:DEFDS_0835 signal
FT                   transduction response regulator; PFAM: EAL domain protein;
FT                   Metal-dependent hydrolase HDOD; SPTR: Diguanylate
FT                   phosphodiesterase, putative; PFAM: EAL domain; HDOD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32790"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014408"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV9"
FT                   /protein_id="ADR32790.1"
FT                   /translation="MGSSYIGRQPIVNERGALFAYDLFSSAQSASEHATETLVNDLQSS
FT                   FGIDKIIGKRLGFIRADHQFIFHELFGLLPKESIVYAVLEESVVDKELCDSLEKLRGQG
FT                   YRFALNDFAYTPENIEKFSPLFPYLEYVKIDIPRSPRIKREDVEQLKQQELTVIGAKIE
FT                   SHDIHAQCVAKGFSYFQGYFISKPKVLENPSFSLDQTAVIQLWNMLQSDADINALVKAF
FT                   ELNHMVSLKLIRFVNSAVFALRNPVSSVRHVLTLMGREPLARWIMLLMFSEAKESDQNN
FT                   IPLMLMVVNRTELMTQLLTLIKPNATESQQATAYFVGMLSLIHLLFNIPHREALKKLNV
FT                   TPEIERALFEGDGFYGELLTTVRSIEMLDTEGIDKFLEKHSLEREVLEPLIASAMEKVN
FT                   QFDEAMG"
     MGSSYIGRQP IVNERGALFA YDLFSSAQSA SEHATETLVN DLQSSFGIDK IIGKRLGFIR        60
     ADHQFIFHEL FGLLPKESIV YAVLEESVVD KELCDSLEKL RGQGYRFALN DFAYTPENIE       120
     KFSPLFPYLE YVKIDIPRSP RIKREDVEQL KQQELTVIGA KIESHDIHAQ CVAKGFSYFQ       180
     GYFISKPKVL ENPSFSLDQT AVIQLWNMLQ SDADINALVK AFELNHMVSL KLIRFVNSAV       240
     FALRNPVSSV RHVLTLMGRE PLARWIMLLM FSEAKESDQN NIPLMLMVVN RTELMTQLLT       300
     LIKPNATESQ QATAYFVGML SLIHLLFNIP HREALKKLNV TPEIERALFE GDGFYGELLT       360
     TVRSIEMLDT EGIDKFLEKH SLEREVLEPL IASAMEKVNQ FDEAMG                      406
//

If you have problems or comments...

PBIL Back to PBIL home page