(data stored in ACNUC7421 zone)

EMBL: CP002355.PE124

CP002355.PE124       Location/Qualifiers
FT   CDS             121869..122678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0125"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0600 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system permease component; InterPro IPR000515;
FT                   KEGG: cja:CJA_2719 ABC transporter, permease protein; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: ABC transporter, permease protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32792"
FT                   /db_xref="GOA:E4TWW1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW1"
FT                   /protein_id="ADR32792.1"
FT                   /translation="MRLINLNAGRFSPLLKILPFVILGLVYWIAADARHALNPEDKLLP
FT                   TFEAIGEAVKTMVMEPDELTEEPILYTDTVASLNRIAQGLGIATAVGLILGIVQGTLPL
FT                   FRSLLSPFSAAVSLIPPIAILPILLIIFGLEESAKVALIAIGVAPFLIRDTQQRSMELS
FT                   EELLIKVQTLGASTWQIILRVVLPHVMPRLLDALRLSLGAAWLFLITAEAIASSEGLGY
FT                   RIFLMRRYMEMDVILPYVAWITLLAFLMDWILAVIIRRAFPWYRKEK"
     MRLINLNAGR FSPLLKILPF VILGLVYWIA ADARHALNPE DKLLPTFEAI GEAVKTMVME        60
     PDELTEEPIL YTDTVASLNR IAQGLGIATA VGLILGIVQG TLPLFRSLLS PFSAAVSLIP       120
     PIAILPILLI IFGLEESAKV ALIAIGVAPF LIRDTQQRSM ELSEELLIKV QTLGASTWQI       180
     ILRVVLPHVM PRLLDALRLS LGAAWLFLIT AEAIASSEGL GYRIFLMRRY MEMDVILPYV       240
     AWITLLAFLM DWILAVIIRR AFPWYRKEK                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page