(data stored in ACNUC7421 zone)

EMBL: CP002355.PE125

CP002355.PE125       Location/Qualifiers
FT   CDS             122678..123454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0126"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1116 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system ATPase component; InterPro IPR017871:
FT                   IPR003439: IPR003593; KEGG: wsu:WS1112 ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: ABC TRANSPORTER, ATP-BINDING PROTEIN;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32793"
FT                   /db_xref="GOA:E4TWW2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW2"
FT                   /protein_id="ADR32793.1"
FT                   /translation="MSYLQIRNVWKTYDDNVILEKLNFTIEKGEFCTLIGPSGCGKSTF
FT                   LRMLLGKESPTRGTILLEGEPLSNEPGSDRGVVFQKYTLFPHLRALENVMLGLEMEHSA
FT                   FLGKAFGSARRRIKEEAMEMIKAVGLEQSAHKYPSELSGGMQQRLSIAQALVKKPKILL
FT                   LDEPFGALDPGSRSDMQELVHGLWQTYGLTAFMVTHDVKEAFELGTRLLVFDKVRNDPH
FT                   SPNAYGATVVNDIKLDKNKRKNKGEGHVDHDETIIA"
     MSYLQIRNVW KTYDDNVILE KLNFTIEKGE FCTLIGPSGC GKSTFLRMLL GKESPTRGTI        60
     LLEGEPLSNE PGSDRGVVFQ KYTLFPHLRA LENVMLGLEM EHSAFLGKAF GSARRRIKEE       120
     AMEMIKAVGL EQSAHKYPSE LSGGMQQRLS IAQALVKKPK ILLLDEPFGA LDPGSRSDMQ       180
     ELVHGLWQTY GLTAFMVTHD VKEAFELGTR LLVFDKVRND PHSPNAYGAT VVNDIKLDKN       240
     KRKNKGEGHV DHDETIIA                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page