(data stored in ACNUC7421 zone)

EMBL: CP002355.PE126

CP002355.PE126       Location/Qualifiers
FT   CDS             123432..124187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0127"
FT                   /product="urea carboxylase-associated protein 2"
FT                   /note="COGs: COG3665 conserved hypothetical protein;
FT                   InterPro IPR017792: IPR018959; KEGG: wsu:WS1113
FT                   hypothetical protein; PFAM: Domain of unknown function
FT                   DUF1989; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   urea carboxylase-associated protein 2; manually curated;
FT                   PFAM: Domain of unknown function (DUF1989); TIGRFAM: urea
FT                   carboxylase-associated protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32794"
FT                   /db_xref="InterPro:IPR017792"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW3"
FT                   /protein_id="ADR32794.1"
FT                   /translation="MMKPLSPETILFDEVLPGGGRWSKIIRKGQVLRILNTEATSGLSA
FT                   LFYNVHERTERYNAADTVKIQYNAYLKQGKALYSDMGRILMSIIEDSCETHDTVCGYTM
FT                   AADVEKLCGLGNYQAKRNCYYKNDFDNFLVEVGKYGMGRRDIMPCLNLFADAKIGERGE
FT                   LIFREDTVPAGSFIELRAEMDVLVILSNTVHVLSTNETYDVKPVNLTVYQGDAVAEDDI
FT                   CVIDSERSERAFVNTRNYMKQFTQGGGNV"
     MMKPLSPETI LFDEVLPGGG RWSKIIRKGQ VLRILNTEAT SGLSALFYNV HERTERYNAA        60
     DTVKIQYNAY LKQGKALYSD MGRILMSIIE DSCETHDTVC GYTMAADVEK LCGLGNYQAK       120
     RNCYYKNDFD NFLVEVGKYG MGRRDIMPCL NLFADAKIGE RGELIFREDT VPAGSFIELR       180
     AEMDVLVILS NTVHVLSTNE TYDVKPVNLT VYQGDAVAED DICVIDSERS ERAFVNTRNY       240
     MKQFTQGGGN V                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page