(data stored in ACNUC7421 zone)

EMBL: CP002355.PE127

CP002355.PE127       Location/Qualifiers
FT   CDS             124180..124821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0128"
FT                   /product="urea carboxylase-associated protein 1"
FT                   /note="COGs: COG3665 conserved hypothetical protein;
FT                   InterPro IPR017791: IPR018959; KEGG: wsu:WS1114
FT                   hypothetical protein; PFAM: Domain of unknown function
FT                   DUF1989; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   urea carboxylase-associated protein 1; PFAM: Domain of
FT                   unknown function (DUF1989); TIGRFAM: urea
FT                   carboxylase-associated protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32795"
FT                   /db_xref="InterPro:IPR017791"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW4"
FT                   /protein_id="ADR32795.1"
FT                   /translation="MSEMITVDLTLNEPIYDETIPAGEPWYHVVKAGEVLRIVDLEGCQ
FT                   AVDTLFYNANDVTERYSAPQTIVRQKNIFVETGTELVSNLGNTMMKVISDTCGRHDTLG
FT                   GACSAESNTVRYALDKLDMHSCRDNYLLALGQMGMDKRDLVSNINFFMNVPVEADGTLA
FT                   IIDGISTPGSTIELIALMDTLVLISNCPQLNNPCNAFNPTPVRLSIYKPF"
     MSEMITVDLT LNEPIYDETI PAGEPWYHVV KAGEVLRIVD LEGCQAVDTL FYNANDVTER        60
     YSAPQTIVRQ KNIFVETGTE LVSNLGNTMM KVISDTCGRH DTLGGACSAE SNTVRYALDK       120
     LDMHSCRDNY LLALGQMGMD KRDLVSNINF FMNVPVEADG TLAIIDGIST PGSTIELIAL       180
     MDTLVLISNC PQLNNPCNAF NPTPVRLSIY KPF                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page