(data stored in ACNUC7421 zone)

EMBL: CP002355.PE128

CP002355.PE128       Location/Qualifiers
FT   CDS             124957..128556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0129"
FT                   /product="urea carboxylase"
FT                   /note="COGs: COG4770 Acetyl/propionyl-CoA carboxylase alpha
FT                   subunit; InterProIPR005479: IPR014084: IPR003778:
FT                   IPR000089: IPR 011761: IPR011764: IPR005481: IPR005482:
FT                   IPR003833; KEGG: slt:Slit_0080 UreA carboxylase; PFAM:
FT                   Allophanate hydrolase subunit 2; Carbamoyl-phosphate
FT                   synthase L chain ATP-binding; Carbamoyl-phosphate
FT                   synthetase large chain domain protein; biotin carboxylase
FT                   domain protein; Allophanate hydrolase subunit 1;
FT                   biotin/lipoyl attachment domain-containing protein; SMART:
FT                   Allophanate hydrolase subunit 2; Allophanate hydrolase
FT                   subunit 1; SPTR: Urea carboxylase; TIGRFAM: urea
FT                   carboxylase; urea amidolyase related protein; PFAM:
FT                   Carbamoyl-phosphate synthase L chain, ATP binding domain;
FT                   Biotin carboxylase C-terminal domain; Allophanate hydrolase
FT                   subunit 2; Allophanate hydrolase subunit 1;
FT                   Carbamoyl-phosphate synthase L chain, N-terminal domain;
FT                   Biotin-requiring enzyme; TIGRFAM: urea carboxylase;
FT                   biotin-dependent carboxylase uncharacterized domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32796"
FT                   /db_xref="GOA:E4TWW5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR014084"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW5"
FT                   /protein_id="ADR32796.1"
FT                   /translation="MFAKVLIANRGEIACRIIRTLKKMKIASVAVYSHADAGSLHVMMA
FT                   DEAICLGEPPAKESYLDVEKIIQAAKETGADAIHPGYGFLSENAAFSRRCAQEGIVFIG
FT                   PTPKHMEDFGLKHTARSMAKAQNVPLLPGTELLENVQEALRAAQEIGYPVMLKSTAGGG
FT                   GIGMQLCYGAEDLENGFESVGRLSKSNFSQGGIYLEKFVASARHIEVQIFGDGKGDVIA
FT                   LGERDCSLQRRNQKVIEETPAPGLSEEVRDALRSAAVNLARSASYKSAGTVEFVYDTTE
FT                   EKFYFLEVNTRLQVEHGVTEEIFGVDLVEWMILEAAGELGDVLKKSYTPSGHSIQVRVY
FT                   AEDPLKNFQPSSGVLSEVVFSENIRCETWIERGSAISPYYDPMIAKLIVHSSSRDEAIE
FT                   AMKSALSETTLYGIVTNIGYLKSVLDEEVFAKGEQTTKYLGTLNYSPAIVEVIKPGTHT
FT                   TVQSAPGRIGYWDIGVPPSGPMDSLSFRLGNRLLGNDEKAPGLEMTVTGSTLKFHFPTR
FT                   IVLTGAAMKAQLNGAEAAYWETIEISAGDILKMGIIEGAGARTYLLIDGGFDVPEYLGS
FT                   TATFTLGEFGGHAGRILQIGDQLSTHRSDEKKFQAVLDAALRPQMAKEWKIGVIYGPHG
FT                   APDFFKEEYIETFFATDWEVHYNSNRTGVRLIGPKPLWAREDGGEAGLHPSNLHDNAYA
FT                   IGTVDFTGDMPVILGPDGPSLGGFVCPVTIVGAELWKMGQLGPKDRVRFIPMTYDDAVK
FT                   MERDLEAKIAGLEGTLPSLPAPTVTNPVVAEIAANDRHDAVKIRLSGDHYILIEFGPME
FT                   LDLTLRFQVHELMRRLKADNDVRLIDLTPGIRSLQIHYESQTLSLTELLEKVKGELSRM
FT                   PATRDIIVPSRTVYLPLSWDDPSTKLAIEKYMQSVRDDAPWCPSNIEFIRRMNGLNGIE
FT                   DVQNILFEAEYLIMGLGDVYLGAPVAVPVDPRHRLVTTKYNPARTWTPENAVGIGGTYM
FT                   CVYGMEGPGGYQFVGRTVQMWNRYKSTTDFKLGKPWLLEFFDRIRFYPVSQNELAQMRK
FT                   DFINGTFSLRIEEGEFSLAEYLEFLETNRESIDAFKTIQQESFNAERQRWEASGISAYV
FT                   SETLETDDESDFAEIPEGCEAVSSFLSGNVWEISVKAGDTVREGDTLVIIEAMKSEVMI
FT                   ESPVAGEVVEVLCVQGDTVHTGHTLVIIKTEGV"
     MFAKVLIANR GEIACRIIRT LKKMKIASVA VYSHADAGSL HVMMADEAIC LGEPPAKESY        60
     LDVEKIIQAA KETGADAIHP GYGFLSENAA FSRRCAQEGI VFIGPTPKHM EDFGLKHTAR       120
     SMAKAQNVPL LPGTELLENV QEALRAAQEI GYPVMLKSTA GGGGIGMQLC YGAEDLENGF       180
     ESVGRLSKSN FSQGGIYLEK FVASARHIEV QIFGDGKGDV IALGERDCSL QRRNQKVIEE       240
     TPAPGLSEEV RDALRSAAVN LARSASYKSA GTVEFVYDTT EEKFYFLEVN TRLQVEHGVT       300
     EEIFGVDLVE WMILEAAGEL GDVLKKSYTP SGHSIQVRVY AEDPLKNFQP SSGVLSEVVF       360
     SENIRCETWI ERGSAISPYY DPMIAKLIVH SSSRDEAIEA MKSALSETTL YGIVTNIGYL       420
     KSVLDEEVFA KGEQTTKYLG TLNYSPAIVE VIKPGTHTTV QSAPGRIGYW DIGVPPSGPM       480
     DSLSFRLGNR LLGNDEKAPG LEMTVTGSTL KFHFPTRIVL TGAAMKAQLN GAEAAYWETI       540
     EISAGDILKM GIIEGAGART YLLIDGGFDV PEYLGSTATF TLGEFGGHAG RILQIGDQLS       600
     THRSDEKKFQ AVLDAALRPQ MAKEWKIGVI YGPHGAPDFF KEEYIETFFA TDWEVHYNSN       660
     RTGVRLIGPK PLWAREDGGE AGLHPSNLHD NAYAIGTVDF TGDMPVILGP DGPSLGGFVC       720
     PVTIVGAELW KMGQLGPKDR VRFIPMTYDD AVKMERDLEA KIAGLEGTLP SLPAPTVTNP       780
     VVAEIAANDR HDAVKIRLSG DHYILIEFGP MELDLTLRFQ VHELMRRLKA DNDVRLIDLT       840
     PGIRSLQIHY ESQTLSLTEL LEKVKGELSR MPATRDIIVP SRTVYLPLSW DDPSTKLAIE       900
     KYMQSVRDDA PWCPSNIEFI RRMNGLNGIE DVQNILFEAE YLIMGLGDVY LGAPVAVPVD       960
     PRHRLVTTKY NPARTWTPEN AVGIGGTYMC VYGMEGPGGY QFVGRTVQMW NRYKSTTDFK      1020
     LGKPWLLEFF DRIRFYPVSQ NELAQMRKDF INGTFSLRIE EGEFSLAEYL EFLETNRESI      1080
     DAFKTIQQES FNAERQRWEA SGISAYVSET LETDDESDFA EIPEGCEAVS SFLSGNVWEI      1140
     SVKAGDTVRE GDTLVIIEAM KSEVMIESPV AGEVVEVLCV QGDTVHTGHT LVIIKTEGV       1199
//

If you have problems or comments...

PBIL Back to PBIL home page