(data stored in ACNUC7421 zone)

EMBL: CP002355.PE130

CP002355.PE130       Location/Qualifiers
FT   CDS             128894..130642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0131"
FT                   /product="allophanate hydrolase"
FT                   /note="COGs: COG0154 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase A subunit and related amidase; InterPro
FT                   IPR013838: IPR014085: IPR000120; KEGG: tgr:Tgr7_3090
FT                   allophanate hydrolase; PFAM: Amidase; SPTR: Allophanate
FT                   hydrolase; TIGRFAM: allophanate hydrolase; PFAM: Amidase;
FT                   TIGRFAM: allophanate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32798"
FT                   /db_xref="GOA:E4TWW7"
FT                   /db_xref="InterPro:IPR014085"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW7"
FT                   /protein_id="ADR32798.1"
FT                   /translation="MRELKTIGDYLHQYRVEGRGVREVIQSCLDKSSMFDDKNIWIAKA
FT                   DTSFLEPYFLRLEGCDPASLPLYGVPFAVKDNIDIAGMNTTAGCAEFSYLPSEHAFVVK
FT                   QLIEAGAIPIGKTNLDQFASGLVGTRSPYGEGINLFNPDYVSGGSSSGSALAVTAGIVP
FT                   FSLGTDTAGSGRVPAAFGNIVGLKPTRGALSIRGVVPACKSLDCVAIFAQNCEDAGRVY
FT                   DLCGIVDDEDSFSRSKSCIIPFGGTFRFGVPREEQLEFFGNSAYESLFWESVKKLESLG
FT                   GIRCEIDFSPFIETAKLLYHGPWIAERYCGIKSFADTQSDAMLDVTRGIILSGAKPSAM
FT                   DAFEGFYRLSELKKISDRIMDSVDMIMTPTAGTIYRRDEIREQPLALNTNLGYYTNFMN
FT                   LLDLSACAVPAGFTSEGLPFGVTLAAPAWYEHSLLNVGAKLHAASGYESGLIEPHQPKT
FT                   VVLAVCGAHMSGLPLNHELTDRGARLVEKSSTAPQYRFFALENFTPPRPGLVQVNEGGG
FT                   TIEVELWEIPSEEFGSFFSGVPSPLALGSLILADGKVVKGFLCESYAVEGAKEITALGG
FT                   WRNYLQ"
     MRELKTIGDY LHQYRVEGRG VREVIQSCLD KSSMFDDKNI WIAKADTSFL EPYFLRLEGC        60
     DPASLPLYGV PFAVKDNIDI AGMNTTAGCA EFSYLPSEHA FVVKQLIEAG AIPIGKTNLD       120
     QFASGLVGTR SPYGEGINLF NPDYVSGGSS SGSALAVTAG IVPFSLGTDT AGSGRVPAAF       180
     GNIVGLKPTR GALSIRGVVP ACKSLDCVAI FAQNCEDAGR VYDLCGIVDD EDSFSRSKSC       240
     IIPFGGTFRF GVPREEQLEF FGNSAYESLF WESVKKLESL GGIRCEIDFS PFIETAKLLY       300
     HGPWIAERYC GIKSFADTQS DAMLDVTRGI ILSGAKPSAM DAFEGFYRLS ELKKISDRIM       360
     DSVDMIMTPT AGTIYRRDEI REQPLALNTN LGYYTNFMNL LDLSACAVPA GFTSEGLPFG       420
     VTLAAPAWYE HSLLNVGAKL HAASGYESGL IEPHQPKTVV LAVCGAHMSG LPLNHELTDR       480
     GARLVEKSST APQYRFFALE NFTPPRPGLV QVNEGGGTIE VELWEIPSEE FGSFFSGVPS       540
     PLALGSLILA DGKVVKGFLC ESYAVEGAKE ITALGGWRNY LQ                          582
//

If you have problems or comments...

PBIL Back to PBIL home page