(data stored in ACNUC7421 zone)

EMBL: CP002355.PE131

CP002355.PE131       Location/Qualifiers
FT   CDS             complement(130823..132040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0132"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_1487 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32799"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW8"
FT                   /protein_id="ADR32799.1"
FT                   /translation="MRVTKISLLASLLLYTSSFAVDNIEVSGAGKFFYGTVDGSPDGTS
FT                   RPNLFNKEGAFAQFGIDMGIAADLGAGFKGKIAGTGLATANMGGNIVNAPWATGMMGSQ
FT                   VWLSEVYLNKNVLDKTAVTLGRQSLDTPFAFTELWNIAANTFDAVLVENTDLSDTTLIG
FT                   AYIDKGNGVNGFATVNPAIADSGKLKNPFKKFYEGAYVVGAKNKSFNGTELQAWFYELK
FT                   NTAKSYWIQGDTEFSGITLGAQAAVLNLDNTLDSSDNSKAYAAKIGYTAIENLTLSAAV
FT                   SQTDKDGSANFQIANLATGGSGGAQSKLYTEAWWNFGYVGKAGTTAYNVTALYTVPEIV
FT                   DLGFFYTDVDQRAANGDNDMREYTLTAAKSFGSLDTSLAYVYSKANDYNDAKYYNNIQV
FT                   YLTYKF"
     MRVTKISLLA SLLLYTSSFA VDNIEVSGAG KFFYGTVDGS PDGTSRPNLF NKEGAFAQFG        60
     IDMGIAADLG AGFKGKIAGT GLATANMGGN IVNAPWATGM MGSQVWLSEV YLNKNVLDKT       120
     AVTLGRQSLD TPFAFTELWN IAANTFDAVL VENTDLSDTT LIGAYIDKGN GVNGFATVNP       180
     AIADSGKLKN PFKKFYEGAY VVGAKNKSFN GTELQAWFYE LKNTAKSYWI QGDTEFSGIT       240
     LGAQAAVLNL DNTLDSSDNS KAYAAKIGYT AIENLTLSAA VSQTDKDGSA NFQIANLATG       300
     GSGGAQSKLY TEAWWNFGYV GKAGTTAYNV TALYTVPEIV DLGFFYTDVD QRAANGDNDM       360
     REYTLTAAKS FGSLDTSLAY VYSKANDYND AKYYNNIQVY LTYKF                       405
//

If you have problems or comments...

PBIL Back to PBIL home page