(data stored in ACNUC7421 zone)

EMBL: CP002355.PE132

CP002355.PE132       Location/Qualifiers
FT   CDS             133180..134520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0133"
FT                   /product="amino acid permease-associated region"
FT                   /note="COGs: COG1113 Gamma-aminobutyrate permease and
FT                   related permease; InterPro IPR002293: IPR004841; KEGG:
FT                   hth:HTH_0635 amino acid permease; PFAM: amino acid
FT                   permease-associated region; SPTR: Amino acid permease;
FT                   PFAM: Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32800"
FT                   /db_xref="GOA:E4TXA3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXA3"
FT                   /protein_id="ADR32800.1"
FT                   /translation="MSGTNGEFRRSLGLMDVTFIGVGAVIGAGIFVITGQAAATMAGPA
FT                   IVLSFLLGAVMIGITALIYAELSSAYPVAGSAYSFTFASLGEVFAWFVGWNLLLEYGVA
FT                   TAAVATGWSGYLRRFLENSMGLHIPQALSGAYNPSAGTYIDISAFGIILAIFVLLAIGI
FT                   KESAKVNTAIVFIKLGVLVTFVVVGLPHVDFHNLSNFFPFGWEGVWHGASLIIFAYLGF
FT                   DAISTVAEETKNPERNIPLGLILSLALSVVFFILVSFTLTAIVPYQELNVPDALAFALY
FT                   KVNEPFAANVIALGAVITITTVMIVMGLGFTRIFFALARDGLLPKTLSEIHPKFNTPYK
FT                   ATIIGGILLSIMAGLIPLKTLAELVNIGTLFAYLMVAVAIIVLRRQNSIQPVFKIPAFK
FT                   ILMPLNFILIIFMMAGLPFETWLRFIGWSVIGMLIYAYYSTKRSKAE"
     MSGTNGEFRR SLGLMDVTFI GVGAVIGAGI FVITGQAAAT MAGPAIVLSF LLGAVMIGIT        60
     ALIYAELSSA YPVAGSAYSF TFASLGEVFA WFVGWNLLLE YGVATAAVAT GWSGYLRRFL       120
     ENSMGLHIPQ ALSGAYNPSA GTYIDISAFG IILAIFVLLA IGIKESAKVN TAIVFIKLGV       180
     LVTFVVVGLP HVDFHNLSNF FPFGWEGVWH GASLIIFAYL GFDAISTVAE ETKNPERNIP       240
     LGLILSLALS VVFFILVSFT LTAIVPYQEL NVPDALAFAL YKVNEPFAAN VIALGAVITI       300
     TTVMIVMGLG FTRIFFALAR DGLLPKTLSE IHPKFNTPYK ATIIGGILLS IMAGLIPLKT       360
     LAELVNIGTL FAYLMVAVAI IVLRRQNSIQ PVFKIPAFKI LMPLNFILII FMMAGLPFET       420
     WLRFIGWSVI GMLIYAYYST KRSKAE                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page