(data stored in ACNUC7421 zone)

EMBL: CP002355.PE135

CP002355.PE135       Location/Qualifiers
FT   CDS             complement(136783..137337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0136"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="COGs: COG0299 Folate-dependent
FT                   phosphoribosylglycinamide formyltransferase PurN; InterPro
FT                   IPR004607: IPR002376; KEGG: nis:NIS_0171
FT                   phosphoribosylglycinamide formyltransferase; PFAM: formyl
FT                   transferase domain protein; SPTR: Phosphoribosylglycinamide
FT                   formyltransferase; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: Formyl transferase; TIGRFAM:
FT                   phosphoribosylglycinamide formyltransferase,
FT                   formyltetrahydrofolate-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32803"
FT                   /db_xref="GOA:E4TXA6"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXA6"
FT                   /protein_id="ADR32803.1"
FT                   /translation="MKKIVALFSGEGTNLANLITKIHLKHAAIVCAITNNPEAGGIAKA
FT                   RSAGIPVEILDHRDFESRELYDEALVSLIQEYNPDLVVLCGFMRILTPVFTSQIRSINL
FT                   HPALLPAFKGARAIERSFESDEKVCGVSVHWVTDELDGGEIILQKSFTKNPNDNLEEFT
FT                   AKIRAIEHEVLPLSILKVLHD"
     MKKIVALFSG EGTNLANLIT KIHLKHAAIV CAITNNPEAG GIAKARSAGI PVEILDHRDF        60
     ESRELYDEAL VSLIQEYNPD LVVLCGFMRI LTPVFTSQIR SINLHPALLP AFKGARAIER       120
     SFESDEKVCG VSVHWVTDEL DGGEIILQKS FTKNPNDNLE EFTAKIRAIE HEVLPLSILK       180
     VLHD                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page