(data stored in ACNUC7421 zone)

EMBL: CP002355.PE136

CP002355.PE136       Location/Qualifiers
FT   CDS             complement(137334..138725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0137"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="COGs: COG0063 sugar kinase; InterPro IPR017953:
FT                   IPR004443: IPR000631; KEGG: nis:NIS_0170 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0031;
FT                   YjeF-family domain-containing protein; SPTR: Putative
FT                   uncharacterized protein; TIGRFAM: carbohydrate kinase, YjeF
FT                   related protein; PFAM: Carbohydrate kinase; YjeF-related
FT                   protein N-terminus; TIGRFAM: yjeF N-terminal region; yjeF
FT                   C-terminal region, hydroxyethylthiazole kinase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32804"
FT                   /db_xref="GOA:E4TXA7"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXA7"
FT                   /protein_id="ADR32804.1"
FT                   /translation="MQNLYLDVSPLDQRGVTKFALSEEVMMEHAAMAMAHLIRARFNAN
FT                   SSVLIVCGSGNNGADGLALARLLEGDFHISLHIPFGASSPLAHLQRDRVEALGLKHAPI
FT                   EGDYDVIVDALFGSGLNRPLGPTAIEALILMNGMSGLKIACDVPSGLYAEGTFDTNVFY
FT                   ADITVTMGAYKRSLFSDGAKEVCGEIIVADLGVHKKRYETPSPWKLLESQDLSLPNRIR
FT                   ASSHKGSYGHLAVVCGEKAGASVIAGSAALRFGTGLVSLISNENVTIPYELMQSHSIPS
FT                   TATAIALGMGLGVEFCDDELSSLLDNTLPLVLDADIFYHPMFSKLLKRTSLVLTPHPKE
FT                   FTQILRLTGIADIDVSALQSNRFTYVEKFCSAYPNTVLVLKGSNVIIGQGEEFYINPLG
FT                   TVALAKGGSGDVLSGLIGALLAQGNTPLEAAIQGSLAHTLAAQKFDKNNYALTPFDLIE
FT                   RITCL"
     MQNLYLDVSP LDQRGVTKFA LSEEVMMEHA AMAMAHLIRA RFNANSSVLI VCGSGNNGAD        60
     GLALARLLEG DFHISLHIPF GASSPLAHLQ RDRVEALGLK HAPIEGDYDV IVDALFGSGL       120
     NRPLGPTAIE ALILMNGMSG LKIACDVPSG LYAEGTFDTN VFYADITVTM GAYKRSLFSD       180
     GAKEVCGEII VADLGVHKKR YETPSPWKLL ESQDLSLPNR IRASSHKGSY GHLAVVCGEK       240
     AGASVIAGSA ALRFGTGLVS LISNENVTIP YELMQSHSIP STATAIALGM GLGVEFCDDE       300
     LSSLLDNTLP LVLDADIFYH PMFSKLLKRT SLVLTPHPKE FTQILRLTGI ADIDVSALQS       360
     NRFTYVEKFC SAYPNTVLVL KGSNVIIGQG EEFYINPLGT VALAKGGSGD VLSGLIGALL       420
     AQGNTPLEAA IQGSLAHTLA AQKFDKNNYA LTPFDLIERI TCL                         463
//

If you have problems or comments...

PBIL Back to PBIL home page