(data stored in ACNUC7421 zone)

EMBL: CP002355.PE137

CP002355.PE137       Location/Qualifiers
FT   CDS             138770..139738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0138"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="COGs: COG0794 sugar phosphate isomerase involved in
FT                   capsule formation; InterPro IPR004800: IPR000644:
FT                   IPR001347; KEGG: nis:NIS_0063 arabinose-5-phosphate
FT                   isomerase; PFAM: sugar isomerase (SIS); CBS domain
FT                   containing protein; PRIAM: Arabinose-5-phosphate isomerase;
FT                   SMART: CBS domain containing protein; SPTR:
FT                   Arabinose-5-phosphate isomerase; TIGRFAM: KpsF/GutQ family
FT                   protein; PFAM: CBS domain; SIS domain; TIGRFAM: KpsF/GutQ
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32805"
FT                   /db_xref="GOA:E4TXA8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXA8"
FT                   /protein_id="ADR32805.1"
FT                   /translation="MNNDYIAIAKNTLEIEAQALREGSERLGEEIARAVEIILSCKGKL
FT                   VITGVGKSGLIGAKIAATFASTGTPSFFLHPTEALHGDLGMIGREDAVLAISYSGESPE
FT                   LSSILPHIKRFDIPLIGMTRNAASTLGRYSDEVININVEHEACPLDIAPTSSTTLTLAM
FT                   GDALAVCLMKARNFQKEDFASFHPGGALGKRLFVKVSDLMRTENLPIVNENTPLKEAIL
FT                   ILSEGRLGTVMLTNNEGKLSGLLSDGDIRRALMSESFSLDASAKAYATKKPLVIDDASM
FT                   LASDALVLIETKKIQLLVVTDRAGVIQGALHLHTLVEAGIS"
     MNNDYIAIAK NTLEIEAQAL REGSERLGEE IARAVEIILS CKGKLVITGV GKSGLIGAKI        60
     AATFASTGTP SFFLHPTEAL HGDLGMIGRE DAVLAISYSG ESPELSSILP HIKRFDIPLI       120
     GMTRNAASTL GRYSDEVINI NVEHEACPLD IAPTSSTTLT LAMGDALAVC LMKARNFQKE       180
     DFASFHPGGA LGKRLFVKVS DLMRTENLPI VNENTPLKEA ILILSEGRLG TVMLTNNEGK       240
     LSGLLSDGDI RRALMSESFS LDASAKAYAT KKPLVIDDAS MLASDALVLI ETKKIQLLVV       300
     TDRAGVIQGA LHLHTLVEAG IS                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page