(data stored in ACNUC7421 zone)

EMBL: CP002355.PE138

CP002355.PE138       Location/Qualifiers
FT   CDS             139735..140682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0139"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="COGs: COG1187 16S rRNA uridine-516 pseudouridylate
FT                   synthase and related pseudouridylate synthase; InterPro
FT                   IPR018496: IPR000748: IPR002942: IPR006145; KEGG:
FT                   tdn:Suden_0212 pseudouridine synthase, Rsu; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase;
FT                   SMART: RNA-binding S4 domain protein; SPTR: Pseudouridine
FT                   synthase; PFAM: RNA pseudouridylate synthase; S4 domain;
FT                   TIGRFAM: pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32806"
FT                   /db_xref="GOA:E4TXA9"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXA9"
FT                   /protein_id="ADR32806.1"
FT                   /translation="MMRLNKFIAHYSTYSRREADQAILDGYVRIDGEIETNPATQVDER
FT                   HANVMISGNKITPTDQFTVIVYNKPRGELVTKKDPQGRKTIYDSLAKQYRHYIPIGRLD
FT                   FASEGLLLLTDASRVATALMTSKMERVYKIKIKGPVTEAMKVAMGEGLELEDASAGAHE
FT                   HAEAGPMSFAPFYAYQVQKDQGDYSVLKVAIGEGQNRELRRFFAHFGAEVVDLKRLSFG
FT                   GIDLNNLPTGKVRFLERSEYASLREFLDALEKAEKQKQKSEKKAPRAEGKSEFKPAKTF
FT                   TKEKSKAKPKSSNEPFGTNKYKPEKKFAKGEHKK"
     MMRLNKFIAH YSTYSRREAD QAILDGYVRI DGEIETNPAT QVDERHANVM ISGNKITPTD        60
     QFTVIVYNKP RGELVTKKDP QGRKTIYDSL AKQYRHYIPI GRLDFASEGL LLLTDASRVA       120
     TALMTSKMER VYKIKIKGPV TEAMKVAMGE GLELEDASAG AHEHAEAGPM SFAPFYAYQV       180
     QKDQGDYSVL KVAIGEGQNR ELRRFFAHFG AEVVDLKRLS FGGIDLNNLP TGKVRFLERS       240
     EYASLREFLD ALEKAEKQKQ KSEKKAPRAE GKSEFKPAKT FTKEKSKAKP KSSNEPFGTN       300
     KYKPEKKFAK GEHKK                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page