(data stored in ACNUC7421 zone)

EMBL: CP002355.PE14

CP002355.PE14        Location/Qualifiers
FT   CDS             15410..16777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0014"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1882 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32682"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW66"
FT                   /protein_id="ADR32682.1"
FT                   /translation="MKKVALSALAAVVISGVASADALTLYSDPKTGQVYTTPGEGRVEM
FT                   GDFVSAKEVDMQMRDLESKGSEYQDKMSKYVNVKSKAKTLEFSGTHYFGLTSASPSTTV
FT                   SDADGSHTSKYAGTSTGFELRRNYVQVKAYFNDKDYFRVTMDTTKELASSTSYANIYAK
FT                   YAYLYLDKVLPYTGVEIGIAHRPWIDYEEHNAWHYRSFNKVVLEEKGTATETGVDLVNS
FT                   ADLGVNFKTQTDAFSSEIGIFNGEGYHADKAAANQENDSKLSLEWRLTGHILGSGTKVG
FT                   KNDRTKDTYANISTYGLISKNHKDDDVDLQGVDSPNEYDRSIYGIHAVYNQPEFLIAAQ
FT                   YFTAKDDKRTQNIATGFDTKDYKGWSVNAEYRPFQDWTVIGRYDNYSIESELNGVDVND
FT                   IEGDKIIAGLAYKYNKNVSFIASAKFADEKDKKVAAKSSDTGESKDVYMLTTEVKW"
     MKKVALSALA AVVISGVASA DALTLYSDPK TGQVYTTPGE GRVEMGDFVS AKEVDMQMRD        60
     LESKGSEYQD KMSKYVNVKS KAKTLEFSGT HYFGLTSASP STTVSDADGS HTSKYAGTST       120
     GFELRRNYVQ VKAYFNDKDY FRVTMDTTKE LASSTSYANI YAKYAYLYLD KVLPYTGVEI       180
     GIAHRPWIDY EEHNAWHYRS FNKVVLEEKG TATETGVDLV NSADLGVNFK TQTDAFSSEI       240
     GIFNGEGYHA DKAAANQEND SKLSLEWRLT GHILGSGTKV GKNDRTKDTY ANISTYGLIS       300
     KNHKDDDVDL QGVDSPNEYD RSIYGIHAVY NQPEFLIAAQ YFTAKDDKRT QNIATGFDTK       360
     DYKGWSVNAE YRPFQDWTVI GRYDNYSIES ELNGVDVNDI EGDKIIAGLA YKYNKNVSFI       420
     ASAKFADEKD KKVAAKSSDT GESKDVYMLT TEVKW                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page