(data stored in ACNUC7421 zone)

EMBL: CP002355.PE140

CP002355.PE140       Location/Qualifiers
FT   CDS             141080..142258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0141"
FT                   /product="Recombination protein MgsA"
FT                   /note="COGs: COG2256 ATPase related to the helicase subunit
FT                   of the Holliday junction resolvase; InterPro IPR003959:
FT                   IPR003593; KEGG: tdn:Suden_0211 recombination factor
FT                   protein RarA; PFAM: AAA ATPase central domain protein;
FT                   SMART: AAA ATPase; SPTR: AAA ATPase; PFAM: MgsA AAA+ ATPase
FT                   C terminal; ATPase family associated with various cellular
FT                   activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32808"
FT                   /db_xref="GOA:E4TXB1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB1"
FT                   /protein_id="ADR32808.1"
FT                   /translation="MADLTYLLRPKKFDDVVGQPHLCSPDSPLRSLCENGNLTHSFFYG
FT                   PPGCGKTTLARIIAEVMGLPFYEFNATSLKIEQLRKIFDQYENSLTKPLIFIDEVHRLA
FT                   KNQQEVLLPVMEKNSVLVIGASTENPYFSLTAAMRSRSLLFELYSITHEALDDLLVRTA
FT                   IEMDEEAREYLIASSGGDARAMLKLLEVSCALNKPITLGLLKSLRPAAQSLGSSEAGVH
FT                   YDLASALIKSIRGSDPDAAIYYLARLIEGGEPPEFIARRLVILSSEDVGNANPQALTLT
FT                   TSAMMSVKQIGYPEARIILAQAVIYLCASPKSNTAYNAINSAQQAVKNGVILDIPTHLR
FT                   QQHKGYLYPHDFGGWVDQQYLSKPLKFVEFKNSGYEAKMGEWIQKVWNRSKV"
     MADLTYLLRP KKFDDVVGQP HLCSPDSPLR SLCENGNLTH SFFYGPPGCG KTTLARIIAE        60
     VMGLPFYEFN ATSLKIEQLR KIFDQYENSL TKPLIFIDEV HRLAKNQQEV LLPVMEKNSV       120
     LVIGASTENP YFSLTAAMRS RSLLFELYSI THEALDDLLV RTAIEMDEEA REYLIASSGG       180
     DARAMLKLLE VSCALNKPIT LGLLKSLRPA AQSLGSSEAG VHYDLASALI KSIRGSDPDA       240
     AIYYLARLIE GGEPPEFIAR RLVILSSEDV GNANPQALTL TTSAMMSVKQ IGYPEARIIL       300
     AQAVIYLCAS PKSNTAYNAI NSAQQAVKNG VILDIPTHLR QQHKGYLYPH DFGGWVDQQY       360
     LSKPLKFVEF KNSGYEAKMG EWIQKVWNRS KV                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page