(data stored in ACNUC7421 zone)

EMBL: CP002355.PE142

CP002355.PE142       Location/Qualifiers
FT   CDS             145987..148578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0143"
FT                   /product="histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR022272: IPR004358: IPR005467: IPR001638: IPR
FT                   003594; KEGG: abu:Abu_1637 two-component sensor histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   extracellular solute-binding protein family 3; SMART:
FT                   ATP-binding region ATPase domain protein; extracellular
FT                   solute-binding protein family 3; SPTR: Histidine kinase;
FT                   PFAM: Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; Bacterial extracellular solute-binding proteins,
FT                   family 3; NMT1/THI5 like"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32810"
FT                   /db_xref="GOA:E4TXB3"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB3"
FT                   /protein_id="ADR32810.1"
FT                   /translation="MKKLFLFLLIFTVSLWGVEKVTLQLPWLHQFQFAGYYVAKEKGYF
FT                   SDEGLDVTILDANKKEASLKSVLDGRAQYGVGHSSLIVNYINGAPIVLMAAAYQSSPMI
FT                   LLTRKDANITGPKDLKNKRVMLTDDMVQWAEIQAMLRSIGMSTKDLIVQPHSYDSMSLS
FT                   RRETDAMVAYVSNEPFILKQAGLETYAIDPKNYGFNYYSDILFTSKEETVRHPERVEAF
FT                   YNASIQGWLWAFDHIEETAALIYRKYNPQHKSLEALIYEGKVLKELAFRPNTPFGTIDQ
FT                   SRLELIAQGYRLMGAVKAIPPFEPLLYKHDKLHLSDQEKEWLKMHPVIRVGVDHNWPPI
FT                   ESVDEKGRYTGISASYLHFLEKRLGVRFDVDYSRPLWSDSIRAVNNKELDMLSCAAIAD
FT                   NRNDKLRFSRPYLKQTVVIVTNSNVGYVNDLNDLNGKKVAVVRSYASEEYLRTYYPKII
FT                   PVLADSSLEALKKVASGEAYACIEGLSVVSYLIERHNLKNIKVVGETPFRYELAFAFRK
FT                   DWGIMASISDKVLASVTPAEYEEIHGHWLEMKHDEPVNYRLVWGIAGFMALLFFLVAYK
FT                   NHRLDVLVRQRTGELETFNQRLQDEVDKAVEKNRKQEKLLMQQAKMAEIGSMLESIAHQ
FT                   WRQPLNILGLSMTRLNLSCALSGKSESAKVIEIAEAQIEYMSQTIDDFRNFFKQDRSQI
FT                   PVNIAAMVNDVEALLGPLLVRKKITVKHEIDPLIEVLVYPNELKQVIINLVNNAREAIE
FT                   QRRGNERIIYIRCENDKRYCTISIEDTGGGIDASIIDKIFDPYFTTKFESQGTGIGLYM
FT                   AKMIIEKHFLGKLSVYNTSKGACFEIRLNREQKKDTEENKVLKRESTDGSL"
     MKKLFLFLLI FTVSLWGVEK VTLQLPWLHQ FQFAGYYVAK EKGYFSDEGL DVTILDANKK        60
     EASLKSVLDG RAQYGVGHSS LIVNYINGAP IVLMAAAYQS SPMILLTRKD ANITGPKDLK       120
     NKRVMLTDDM VQWAEIQAML RSIGMSTKDL IVQPHSYDSM SLSRRETDAM VAYVSNEPFI       180
     LKQAGLETYA IDPKNYGFNY YSDILFTSKE ETVRHPERVE AFYNASIQGW LWAFDHIEET       240
     AALIYRKYNP QHKSLEALIY EGKVLKELAF RPNTPFGTID QSRLELIAQG YRLMGAVKAI       300
     PPFEPLLYKH DKLHLSDQEK EWLKMHPVIR VGVDHNWPPI ESVDEKGRYT GISASYLHFL       360
     EKRLGVRFDV DYSRPLWSDS IRAVNNKELD MLSCAAIADN RNDKLRFSRP YLKQTVVIVT       420
     NSNVGYVNDL NDLNGKKVAV VRSYASEEYL RTYYPKIIPV LADSSLEALK KVASGEAYAC       480
     IEGLSVVSYL IERHNLKNIK VVGETPFRYE LAFAFRKDWG IMASISDKVL ASVTPAEYEE       540
     IHGHWLEMKH DEPVNYRLVW GIAGFMALLF FLVAYKNHRL DVLVRQRTGE LETFNQRLQD       600
     EVDKAVEKNR KQEKLLMQQA KMAEIGSMLE SIAHQWRQPL NILGLSMTRL NLSCALSGKS       660
     ESAKVIEIAE AQIEYMSQTI DDFRNFFKQD RSQIPVNIAA MVNDVEALLG PLLVRKKITV       720
     KHEIDPLIEV LVYPNELKQV IINLVNNARE AIEQRRGNER IIYIRCENDK RYCTISIEDT       780
     GGGIDASIID KIFDPYFTTK FESQGTGIGL YMAKMIIEKH FLGKLSVYNT SKGACFEIRL       840
     NREQKKDTEE NKVLKRESTD GSL                                               863
//

If you have problems or comments...

PBIL Back to PBIL home page