(data stored in ACNUC7421 zone)

EMBL: CP002355.PE143

CP002355.PE143       Location/Qualifiers
FT   CDS             148820..149356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0144"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="COGs: COG0225 Peptide methionine sulfoxide
FT                   reductase; InterPro IPR002569; KEGG: cts:Ctha_2671 peptide
FT                   methionine sulfoxide reductase; PFAM: Methionine sulfoxide
FT                   reductase A; PRIAM: Peptide-methionine (S)-S-oxide
FT                   reductase; SPTR: Peptide methionine sulfoxide reductase
FT                   msrA; TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Peptide methionine sulfoxide reductase; TIGRFAM:
FT                   methionine-S-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32811"
FT                   /db_xref="GOA:E4TXB4"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB4"
FT                   /protein_id="ADR32811.1"
FT                   /translation="MGTMEKALIGGGCFWCIEAVYNRVIGVQSAISGYAGGARKHPSYE
FT                   QVCSGATGHAEVVEVTYDSAVISYEEILEIFWAIHDPTTLNAQGADRGTQYRSVIYYYD
FT                   EVQKEKAEASIAQAQKNWTDPIVTERSPAPEFFVAEEYHQDYYSEHPTQGYCYAVIAPK
FT                   IEKFMKKFGDKVKRS"
     MGTMEKALIG GGCFWCIEAV YNRVIGVQSA ISGYAGGARK HPSYEQVCSG ATGHAEVVEV        60
     TYDSAVISYE EILEIFWAIH DPTTLNAQGA DRGTQYRSVI YYYDEVQKEK AEASIAQAQK       120
     NWTDPIVTER SPAPEFFVAE EYHQDYYSEH PTQGYCYAVI APKIEKFMKK FGDKVKRS         178
//

If you have problems or comments...

PBIL Back to PBIL home page