(data stored in ACNUC7421 zone)

EMBL: CP002355.PE144

CP002355.PE144       Location/Qualifiers
FT   CDS             149519..150304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0145"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tmt:Tmath_2211 hypothetical protein; SPTR:
FT                   Spore photoproduct lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32812"
FT                   /db_xref="GOA:E4TXB5"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB5"
FT                   /protein_id="ADR32812.1"
FT                   /translation="MIYLITALDAEAKPLWDHYRLKRDSSLPYTLYRNDEMTLLVGGIG
FT                   KANTMMALSALLGWRIPETGDILINIGICGAPSEYTIGEALLIHQIFEGERRYYPDILY
FT                   PHTLRESSLVCINSPQSIVRDYPVDMESSALFQAASRFFKLHQMAFIKIVSDHFTPESV
FT                   TKEGAMDLVRSHVKTLDELIRNLQSVQVDSLLFTSEERQKIDALKGHFTKSQGDALEDA
FT                   LNYFRLKNPEQSLKIDHDIPHSKRERSQLLETLIIALTA"
     MIYLITALDA EAKPLWDHYR LKRDSSLPYT LYRNDEMTLL VGGIGKANTM MALSALLGWR        60
     IPETGDILIN IGICGAPSEY TIGEALLIHQ IFEGERRYYP DILYPHTLRE SSLVCINSPQ       120
     SIVRDYPVDM ESSALFQAAS RFFKLHQMAF IKIVSDHFTP ESVTKEGAMD LVRSHVKTLD       180
     ELIRNLQSVQ VDSLLFTSEE RQKIDALKGH FTKSQGDALE DALNYFRLKN PEQSLKIDHD       240
     IPHSKRERSQ LLETLIIALT A                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page