(data stored in ACNUC7421 zone)

EMBL: CP002355.PE145

CP002355.PE145       Location/Qualifiers
FT   CDS             150273..151292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0146"
FT                   /product="DNA repair photolyase-like protein"
FT                   /note="COGs: COG1533 DNA repair photolyase; KEGG:
FT                   csc:Csac_0382 DNA repair photolyase-like protein; SPTR: DNA
FT                   repair photolyase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32813"
FT                   /db_xref="GOA:E4TXB6"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB6"
FT                   /protein_id="ADR32813.1"
FT                   /translation="MKHSSLPSQPKLFSHLYIERGILEHPQTQMIRVKFSDSQVIVIEH
FT                   YKEVFNRSAQSFAAQSSAKKLILARKEGKFLHEGSQYSDGFGIKQFFYASSVMGCLYDC
FT                   DYCYLQGLYPSANTVLFVNLEDAFEQLTPYLGEDTLVATSYDTDTMAIESLTHQTKSWL
FT                   DFAAQNEKLHLEIRTKSANIKALKNNIPNDRVTLAWTLSPQEIIDRYEHATPSLQKRLS
FT                   AVREAIQLGWKVRLCIDPVIYTENFDSLYPQLIETIFATIDPESIEHLTLGSFRMSQSH
FT                   LRSLKKLRRSDVAFFPYTVKDEMATYPETVESYILETLLAKATQYLPQERIRTWQRQS"
     MKHSSLPSQP KLFSHLYIER GILEHPQTQM IRVKFSDSQV IVIEHYKEVF NRSAQSFAAQ        60
     SSAKKLILAR KEGKFLHEGS QYSDGFGIKQ FFYASSVMGC LYDCDYCYLQ GLYPSANTVL       120
     FVNLEDAFEQ LTPYLGEDTL VATSYDTDTM AIESLTHQTK SWLDFAAQNE KLHLEIRTKS       180
     ANIKALKNNI PNDRVTLAWT LSPQEIIDRY EHATPSLQKR LSAVREAIQL GWKVRLCIDP       240
     VIYTENFDSL YPQLIETIFA TIDPESIEHL TLGSFRMSQS HLRSLKKLRR SDVAFFPYTV       300
     KDEMATYPET VESYILETLL AKATQYLPQE RIRTWQRQS                              339
//

If you have problems or comments...

PBIL Back to PBIL home page