(data stored in ACNUC7421 zone)

EMBL: CP002355.PE146

CP002355.PE146       Location/Qualifiers
FT   CDS             151274..151960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0147"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG0300 Short-chain dehydrogenase of various
FT                   substrate specificities; InterPro IPR002347: IPR002198;
FT                   KEGG: ant:Arnit_0526 short-chain dehydrogenase/reductase
FT                   SDR; PFAM: short-chain dehydrogenase/reductase SDR; SPTR:
FT                   Probable short-chain dehydrogenase; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32814"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB7"
FT                   /protein_id="ADR32814.1"
FT                   /translation="MATAIVTGTSSGIGEAIAQILLQNGYNVIGLSRRRGDIHHPLFEH
FT                   LPCDLSDLAVVDILQKKLTEIEDLEILVNAAGFGRFEPHEELSSKTITDMISLNLTTPI
FT                   LLANALMRPLKKTKGMIINITSIEATRHSKFSALYSATKAGLRAFGLTLFEETRNAGVK
FT                   VVTINPDMTETPFFDGFRFGVGKEDDTKLLTSDIAQAVQYLLDTREGICVTEMTIRSQR
FT                   FGITKK"
     MATAIVTGTS SGIGEAIAQI LLQNGYNVIG LSRRRGDIHH PLFEHLPCDL SDLAVVDILQ        60
     KKLTEIEDLE ILVNAAGFGR FEPHEELSSK TITDMISLNL TTPILLANAL MRPLKKTKGM       120
     IINITSIEAT RHSKFSALYS ATKAGLRAFG LTLFEETRNA GVKVVTINPD MTETPFFDGF       180
     RFGVGKEDDT KLLTSDIAQA VQYLLDTREG ICVTEMTIRS QRFGITKK                    228
//

If you have problems or comments...

PBIL Back to PBIL home page