(data stored in ACNUC7421 zone)

EMBL: CP002355.PE147

CP002355.PE147       Location/Qualifiers
FT   CDS             152062..153774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0148"
FT                   /product="flagellar hook-associated 2 domain-containing
FT                   protein"
FT                   /note="COGs: COG1345 Flagellar capping protein; InterPro
FT                   IPR003481: IPR010810: IPR010809; KEGG: wsu:WS0150 flagellar
FT                   capping protein; PFAM: flagellar hook-associated 2
FT                   domain-containing protein; flagellar hook-associated
FT                   protein 2 domain-containing protein; flagellin hook IN
FT                   repeat protein; SPTR: FLAGELLAR HOOK-ASSOCIATED PROTEIN 2;
FT                   PFAM: Flagellar hook-associated protein 2 C-terminus;
FT                   Flagellin hook IN motif"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32815"
FT                   /db_xref="GOA:E4TXB8"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB8"
FT                   /protein_id="ADR32815.1"
FT                   /translation="MSGTINSLGLGSGVLTADLIDKLKASDEAVSVTPFDSKISLNKQK
FT                   SQALDLLNSLLTTFKSSVNALDNDSLYQKRSVSGTNDGVSVSASAGSQIRDFSIGITNI
FT                   AKKNVVQSASFSSNTDKIANTDGKLNLNISGKNYTIDYTATTTLDDIKQSINDAAGSDV
FT                   SASVLQTGTSAYSLVVTSKVTGKEQTISLTDISGNLKNNNLVSEGVASGSFIAADDFIA
FT                   NTGAAGTMSVNVGGVGYNFAYDDTTTLEQMVDNINNDSTLSGKISASIVQYGANDYRMV
FT                   LTPKDGTEGSAITITDTPSSGTGLVGVMTGTTDKGGLVNTVQNGQDASFTFDGIAMTRS
FT                   TNTITDIATGLTINLLQDGGSSNISISQDRDQIATELEGLVSSYNTLQQQLDSMLSSDS
FT                   EAGTVGIFNGDNTIRNIGREITKMINSVDSKGSSLANYGIDLTRDGTMTFDKSVFTEKM
FT                   DADPEGTEAFFSGKTTVNSVGSETYTKGVFTTLSDLMTSYVGSSGTVTNLVTDTKSATT
FT                   SLNEERAKAVKLLEARYATLTAKFAAYDSMISKLNSQFSALQQQIDAAANANN"
     MSGTINSLGL GSGVLTADLI DKLKASDEAV SVTPFDSKIS LNKQKSQALD LLNSLLTTFK        60
     SSVNALDNDS LYQKRSVSGT NDGVSVSASA GSQIRDFSIG ITNIAKKNVV QSASFSSNTD       120
     KIANTDGKLN LNISGKNYTI DYTATTTLDD IKQSINDAAG SDVSASVLQT GTSAYSLVVT       180
     SKVTGKEQTI SLTDISGNLK NNNLVSEGVA SGSFIAADDF IANTGAAGTM SVNVGGVGYN       240
     FAYDDTTTLE QMVDNINNDS TLSGKISASI VQYGANDYRM VLTPKDGTEG SAITITDTPS       300
     SGTGLVGVMT GTTDKGGLVN TVQNGQDASF TFDGIAMTRS TNTITDIATG LTINLLQDGG       360
     SSNISISQDR DQIATELEGL VSSYNTLQQQ LDSMLSSDSE AGTVGIFNGD NTIRNIGREI       420
     TKMINSVDSK GSSLANYGID LTRDGTMTFD KSVFTEKMDA DPEGTEAFFS GKTTVNSVGS       480
     ETYTKGVFTT LSDLMTSYVG SSGTVTNLVT DTKSATTSLN EERAKAVKLL EARYATLTAK       540
     FAAYDSMISK LNSQFSALQQ QIDAAANANN                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page