(data stored in ACNUC7421 zone)

EMBL: CP002355.PE149

CP002355.PE149       Location/Qualifiers
FT   CDS             154053..155060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0150"
FT                   /product="UDP-N-acetylglucosamine 4,6-dehydratase"
FT                   /note="COGs: COG1086 nucleoside-diphosphate sugar
FT                   epimerase; InterPro IPR020025: IPR003869; KEGG:
FT                   sdl:Sdel_2208 UDP-N-acetylglucosamine 4,6-dehydratase;
FT                   PFAM: polysaccharide biosynthesis protein CapD; SPTR:
FT                   UDP-N-acetylglucosamine 4,6-dehydratase; TIGRFAM:
FT                   UDP-N-acetylglucosamine 4,6-dehydratase; PFAM:
FT                   Polysaccharide biosynthesis protein; TIGRFAM:
FT                   UDP-N-acetylglucosamine 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32817"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR020025"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC0"
FT                   /protein_id="ADR32817.1"
FT                   /translation="MLNGKNILITGGTGSFGKQFVKTILKRYKPNKIIIYSRDELKQYE
FT                   MAQRFNDPCMRYFIGDVRDLSRLESAMSGVDYVVHAAALKHVPIAEYNPMECIKTNING
FT                   AQNVIDAALHCGVSRVIALSTDKAASPINLYGATKLASDKLFVAANNIRGGKDIRFAVV
FT                   RYGNVLGSRGSVVPFFQKLIAEGAKELPITDERMTRFWITLQEGVDFVLKNFQRMHGGE
FT                   TFIPKIPSMKVVDVATAIAPHLPHKNVGIRPGEKMHEVMCPRDDSHLTLEFHDHYVIKP
FT                   TIQFTEAADFAKNNCGEIGTPVEYGFKYSSETNTDWLTPEALLEKIALTENEEK"
     MLNGKNILIT GGTGSFGKQF VKTILKRYKP NKIIIYSRDE LKQYEMAQRF NDPCMRYFIG        60
     DVRDLSRLES AMSGVDYVVH AAALKHVPIA EYNPMECIKT NINGAQNVID AALHCGVSRV       120
     IALSTDKAAS PINLYGATKL ASDKLFVAAN NIRGGKDIRF AVVRYGNVLG SRGSVVPFFQ       180
     KLIAEGAKEL PITDERMTRF WITLQEGVDF VLKNFQRMHG GETFIPKIPS MKVVDVATAI       240
     APHLPHKNVG IRPGEKMHEV MCPRDDSHLT LEFHDHYVIK PTIQFTEAAD FAKNNCGEIG       300
     TPVEYGFKYS SETNTDWLTP EALLEKIALT ENEEK                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page