(data stored in ACNUC7421 zone)

EMBL: CP002355.PE15

CP002355.PE15        Location/Qualifiers
FT   CDS             complement(16875..18140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_2284 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32683"
FT                   /db_xref="GOA:E4TW67"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW67"
FT                   /protein_id="ADR32683.1"
FT                   /translation="MYNGLSLDQAPPISAVMRFFLTVPLFGILLSLSIFFHPEAVLTPA
FT                   HPISLAVIHMMFLGVITMAMIGALFQMQSVLGGRPIPAASGNALIIHVFLTVGILSLSG
FT                   AFAFNASVMFIVAAVFLASSILYTANLILPLLFGGVTHDTLRGMRLALISLSLTALFGI
FT                   VMASSYANSSFSTMHDAIRTSHYSLGLIGWIGTLIVAVAFQVIEMFYVTIPYNGWCKRN
FT                   AFRIIAASLFLKVVWLFFAFPYVWIFDLTLGALFTGFIITTLKRLQLRKRRVSDVSILF
FT                   WTTGIALLYIAIMAYGVYEWGNYKPLLSISLIAFILFSLSIILGMMGKIVPFLVWFHLS
FT                   SNGIMDAPIMSNIIPQSRAKTLFSLFLLTTFSLLGGIFVLELFVVGAIAASAMFALLLF
FT                   NLINALRVYRFSMIHGLRFEQI"
     MYNGLSLDQA PPISAVMRFF LTVPLFGILL SLSIFFHPEA VLTPAHPISL AVIHMMFLGV        60
     ITMAMIGALF QMQSVLGGRP IPAASGNALI IHVFLTVGIL SLSGAFAFNA SVMFIVAAVF       120
     LASSILYTAN LILPLLFGGV THDTLRGMRL ALISLSLTAL FGIVMASSYA NSSFSTMHDA       180
     IRTSHYSLGL IGWIGTLIVA VAFQVIEMFY VTIPYNGWCK RNAFRIIAAS LFLKVVWLFF       240
     AFPYVWIFDL TLGALFTGFI ITTLKRLQLR KRRVSDVSIL FWTTGIALLY IAIMAYGVYE       300
     WGNYKPLLSI SLIAFILFSL SIILGMMGKI VPFLVWFHLS SNGIMDAPIM SNIIPQSRAK       360
     TLFSLFLLTT FSLLGGIFVL ELFVVGAIAA SAMFALLLFN LINALRVYRF SMIHGLRFEQ       420
     I                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page