(data stored in ACNUC7421 zone)

EMBL: CP002355.PE150

CP002355.PE150       Location/Qualifiers
FT   CDS             155057..156184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0151"
FT                   /product="UDP-4-keto-6-deoxy-N-acetylglucosamine
FT                   4-aminotransferase"
FT                   /note="COGs: COG0399 pyridoxal phosphate-dependent enzyme
FT                   apparently involved in regulation of cell wall biogenesis;
FT                   InterPro IPR000653: IPR020026; KEGG: sdl:Sdel_2209
FT                   UDP-4-keto-6-deoxy-N-acetylglucosamine4-aminotra nsferase;
FT                   PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   SPTR:UDP-4-keto-6-deoxy-N-acetylglucosamine4-aminot
FT                   ransferase; TIGRFAM: UDP-4-keto-6-deoxy-N-acetylglucosamine
FT                   4-aminotransferase; PFAM: DegT/DnrJ/EryC1/StrS
FT                   aminotransferase family; TIGRFAM:
FT                   UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32818"
FT                   /db_xref="GOA:E4TXC1"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020026"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC1"
FT                   /protein_id="ADR32818.1"
FT                   /translation="MIPYSTQFIEEDDIAAVVDVLKSSHLTQGAKVEEFEAAIAEYVGA
FT                   RFCVAFNSATSALLGAYAVAEIGENDEIITTPISFVATSNMAIALGAKPVFCDVKTDGN
FT                   IDESLIESLITPRTRALVPVDFAGKPVAIEAIKAIAKKHNLLVIEDSSHALGSGIGTQR
FT                   IGSFADMTIFSFHAIKPITTGEGGAVVTNDEAFAQKLKLFRSHGIIKKQLWNSDMVSLG
FT                   HNFRLTEFAAALGLSQLHKLDRFLATRNEIARYYDERFAGHKLFATIAIDADEQSARHL
FT                   YPLLLSPALHCSKEDVFTELQTRGLGVQVHYKPIYQNSFYKERFGEQRLANTEHFYKSS
FT                   LSIPCHQKMSMEDARIVADTVLEVMEHYSHRECSF"
     MIPYSTQFIE EDDIAAVVDV LKSSHLTQGA KVEEFEAAIA EYVGARFCVA FNSATSALLG        60
     AYAVAEIGEN DEIITTPISF VATSNMAIAL GAKPVFCDVK TDGNIDESLI ESLITPRTRA       120
     LVPVDFAGKP VAIEAIKAIA KKHNLLVIED SSHALGSGIG TQRIGSFADM TIFSFHAIKP       180
     ITTGEGGAVV TNDEAFAQKL KLFRSHGIIK KQLWNSDMVS LGHNFRLTEF AAALGLSQLH       240
     KLDRFLATRN EIARYYDERF AGHKLFATIA IDADEQSARH LYPLLLSPAL HCSKEDVFTE       300
     LQTRGLGVQV HYKPIYQNSF YKERFGEQRL ANTEHFYKSS LSIPCHQKMS MEDARIVADT       360
     VLEVMEHYSH RECSF                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page