(data stored in ACNUC7421 zone)

EMBL: CP002355.PE152

CP002355.PE152       Location/Qualifiers
FT   CDS             156878..157741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0153"
FT                   /product="pseudaminic acid biosynthesis-associated protein
FT                   PseG"
FT                   /note="COGs: COG3980 Spore coat polysaccharide biosynthesis
FT                   protein predicted glycosyltransferase; InterPro IPR020023;
FT                   KEGG: sdl:Sdel_2211 pseudaminic acid
FT                   biosynthesis-associated protein PseG; SPTR: Pseudaminic
FT                   acid biosynthesis-associated protein PseG; TIGRFAM:
FT                   pseudaminic acid biosynthesis-associated protein PseG;
FT                   TIGRFAM: pseudaminic acid biosynthesis-associated protein
FT                   PseG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32820"
FT                   /db_xref="InterPro:IPR020023"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC3"
FT                   /protein_id="ADR32820.1"
FT                   /translation="MNLLIRADSSSSIGLGHIMRDVVFAAQYSQDSVRFACQNLSGNII
FT                   DHIPYPVHILDSNDPEELIALIREQRIDRVVFDHYGIDEIFEKKIKEACGVSILSFDDT
FT                   YEKHYCDILLNHNISADKNRYVGLVPPHCELRCGGEYTLIRDEFKTEKQVKREKLYDVF
FT                   IAMGGTDPTNATMNILSTLSDEMRVCIVTTSGNPHVSELETCVQERKNITLEIDSARIA
FT                   QLLHQSRLAIITPSVMVHEVLFMEVPFIAVQTAANQEDMVVYLQQEGYIVLKEWDAGAI
FT                   ARFYNA"
     MNLLIRADSS SSIGLGHIMR DVVFAAQYSQ DSVRFACQNL SGNIIDHIPY PVHILDSNDP        60
     EELIALIREQ RIDRVVFDHY GIDEIFEKKI KEACGVSILS FDDTYEKHYC DILLNHNISA       120
     DKNRYVGLVP PHCELRCGGE YTLIRDEFKT EKQVKREKLY DVFIAMGGTD PTNATMNILS       180
     TLSDEMRVCI VTTSGNPHVS ELETCVQERK NITLEIDSAR IAQLLHQSRL AIITPSVMVH       240
     EVLFMEVPFI AVQTAANQED MVVYLQQEGY IVLKEWDAGA IARFYNA                     287
//

If you have problems or comments...

PBIL Back to PBIL home page