(data stored in ACNUC7421 zone)

EMBL: CP002355.PE154

CP002355.PE154       Location/Qualifiers
FT   CDS             158171..159205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0155"
FT                   /product="N-acetylneuraminate synthase"
FT                   /EC_number="2.5.1.56"
FT                   /note="COGs: COG2089 Sialic acid synthase; InterPro
FT                   IPR020030: IPR006190: IPR013132: IPR013974; KEGG:
FT                   tmt:Tmath_0718 pseudaminic acid synthase; PFAM:
FT                   N-acetylneuraminic acid synthase domain; SAF domain
FT                   protein; PRIAM: N-acetylneuraminate synthase; SPTR:
FT                   Pseudaminic acid synthase; TIGRFAM: pseudaminic acid
FT                   synthase; PFAM: SAF domain; NeuB family; TIGRFAM:
FT                   pseudaminic acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32822"
FT                   /db_xref="GOA:E4TXC5"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020030"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC5"
FT                   /protein_id="ADR32822.1"
FT                   /translation="MNIAHHNTDEKVFIIAELSANHNGSLDTALRTITAMKDAGADAVK
FT                   LQTYTPDTITLDCDSEMFTISQGTLWDKRKFHDLYAEAMTPWEWHPILFDHAKSLGMAA
FT                   FSSPFDVSAVDFLESLDVPAYKIASFEITDIPLIEYTAAKGKPIIISTGIATLSDIEEA
FT                   LDACRRVGNEQIMLLKCTSAYPAALEEMNLLTIADMKIRFGVNVGLSDHTMSLAAPIAA
FT                   VALGARVIEKHFILDRGMGGADSAFSLEPHEFKMMVDAVRDTEKLLGKVTYELSPKSLK
FT                   SREFSRSLFIAEDVKEGEVISDKNVRSVRPGFGLAPKHLKEILGKTFKAGAIKGTPLSW
FT                   DHIG"
     MNIAHHNTDE KVFIIAELSA NHNGSLDTAL RTITAMKDAG ADAVKLQTYT PDTITLDCDS        60
     EMFTISQGTL WDKRKFHDLY AEAMTPWEWH PILFDHAKSL GMAAFSSPFD VSAVDFLESL       120
     DVPAYKIASF EITDIPLIEY TAAKGKPIII STGIATLSDI EEALDACRRV GNEQIMLLKC       180
     TSAYPAALEE MNLLTIADMK IRFGVNVGLS DHTMSLAAPI AAVALGARVI EKHFILDRGM       240
     GGADSAFSLE PHEFKMMVDA VRDTEKLLGK VTYELSPKSL KSREFSRSLF IAEDVKEGEV       300
     ISDKNVRSVR PGFGLAPKHL KEILGKTFKA GAIKGTPLSW DHIG                        344
//

If you have problems or comments...

PBIL Back to PBIL home page