(data stored in ACNUC7421 zone)

EMBL: CP002355.PE156

CP002355.PE156       Location/Qualifiers
FT   CDS             160199..161146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0157"
FT                   /product="oxidoreductase domain protein"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR000683; KEGG: mag:amb3807 dehydrogenase and
FT                   related protein; PFAM: oxidoreductase domain protein; SPTR:
FT                   Predicted dehydrogenase and related protein; PFAM:
FT                   Oxidoreductase family, NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32824"
FT                   /db_xref="GOA:E4TXC7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC7"
FT                   /protein_id="ADR32824.1"
FT                   /translation="MYKALIIGAGSIGGLIDSPTSKTVASHAHAYKKHPDTQLYAICEP
FT                   SELNVFAFMERWGEVHHYGSIDEISTDELYDIVSISSPTKSHFYDLITLLKRSDSSMIL
FT                   CEKPLVATQEELSSLSTLLMHSDKKILVHFVRRYNSAFINLAERIQKGEFGKSLGFQGV
FT                   CTKGLLHNGSHMIAVLSHFLGNVTSIKPFRASFCHDDLCGDFGISLERGDGAISVLSHP
FT                   PYSLFEITFWFETGVIKILDGGDKIEIYSRVPSTYEGYFSLALQESMTTNLSNYAYDSV
FT                   EFLLRKSKETCKNILSEHFHIHKMIFQTLAKVYP"
     MYKALIIGAG SIGGLIDSPT SKTVASHAHA YKKHPDTQLY AICEPSELNV FAFMERWGEV        60
     HHYGSIDEIS TDELYDIVSI SSPTKSHFYD LITLLKRSDS SMILCEKPLV ATQEELSSLS       120
     TLLMHSDKKI LVHFVRRYNS AFINLAERIQ KGEFGKSLGF QGVCTKGLLH NGSHMIAVLS       180
     HFLGNVTSIK PFRASFCHDD LCGDFGISLE RGDGAISVLS HPPYSLFEIT FWFETGVIKI       240
     LDGGDKIEIY SRVPSTYEGY FSLALQESMT TNLSNYAYDS VEFLLRKSKE TCKNILSEHF       300
     HIHKMIFQTL AKVYP                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page